GapMind for catabolism of small carbon sources

 

Aligments for a candidate for BPHYT_RS16925 in Escherichia coli BW25113

Align Arabinose ABC transporter permease (characterized, see rationale)
to candidate 1936623 b4460 fused L-arabinose transporter subunits of ABC superfamily: membrane components (RefSeq)

Query= uniprot:A0A161GM94
         (322 letters)



>lcl|FitnessBrowser__Keio:1936623 b4460 fused L-arabinose
           transporter subunits of ABC superfamily: membrane
           components (RefSeq)
          Length = 328

 Score =  382 bits (982), Expect = e-111
 Identities = 190/304 (62%), Positives = 238/304 (78%)

Query: 19  RFLDDWVMLLAAIGIFVLCTLMIDNFLSPLNMRGLGLAISTTGIAACTMLYCLASGHFDL 78
           R  D + ML+    +F+ C + + NF + +NM+GLGLAIS +G+ AC ML+CLASG FDL
Sbjct: 20  RIWDQYGMLVVFAVLFIACAIFVPNFATFINMKGLGLAISMSGMVACGMLFCLASGDFDL 79

Query: 79  SVGSVIACAGVVAAVVMRDTNSVFLGISAALVMGLIVGLINGIVIAKLRVNALITTLATM 138
           SV SVIACAGV  AVV+  T S+++G++A L++G++ GL+NG VIAKL++NALITTLATM
Sbjct: 80  SVASVIACAGVTTAVVINLTESLWIGVAAGLLLGVLCGLVNGFVIAKLKINALITTLATM 139

Query: 139 QIVRGLAYIFANGKAVGVSQESFFVFGNGQMFGVPVPILITIVCFLFFGWLLNYTTYGRN 198
           QIVRGLAYI ++GKAVG+  ESFF  G    FG+P PI +T+ C + FG LLN TT+GRN
Sbjct: 140 QIVRGLAYIISDGKAVGIEDESFFALGYANWFGLPAPIWLTVACLIIFGLLLNKTTFGRN 199

Query: 199 TMAIGGNQEAALLAGVNVDRTKIIIFAVHGVIGALAGVILASRMTSGQPMIGQGFELTVI 258
           T+AIGGN+EAA LAGV V RTKIIIF + G++ A+AG+ILASRMTSGQPM   G+EL VI
Sbjct: 200 TLAIGGNEEAARLAGVPVVRTKIIIFVLSGLVSAIAGIILASRMTSGQPMTSIGYELIVI 259

Query: 259 SACVLGGVSLSGGIGMIRHVIAGVLILAIIENAMNLKNIDTFYQYVIRGSILLLAVVIDR 318
           SACVLGGVSL GGIG I +V+AG+LIL  +ENAMNL NI  F QYV+RG ILL AV+ DR
Sbjct: 260 SACVLGGVSLKGGIGKISYVVAGILILGTVENAMNLLNISPFAQYVVRGLILLAAVIFDR 319

Query: 319 LKQR 322
            KQ+
Sbjct: 320 YKQK 323


Lambda     K      H
   0.330    0.144    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 351
Number of extensions: 11
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 322
Length of database: 328
Length adjustment: 28
Effective length of query: 294
Effective length of database: 300
Effective search space:    88200
Effective search space used:    88200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory