Align PTS system galactose-specific EIIC component (characterized)
to candidate 15855 b1737 N,N'-diacetylchitobiose-specific enzyme IIC component of PTS (NCBI)
Query= SwissProt::A2RJV0 (451 letters) >FitnessBrowser__Keio:15855 Length = 452 Score = 155 bits (393), Expect = 2e-42 Identities = 142/477 (29%), Positives = 207/477 (43%), Gaps = 76/477 (15%) Query: 8 LNKTLMPLASKMNKNHFISALSEAFMRCMPLTLGIALLTIIG-YFPVPAWVDFLNSIGLA 66 L K L+P A K+ K ++A+ F+R MPLTL A+ +I F F S+G+ Sbjct: 8 LEKVLLPFAVKIGKQPHVNAIKNGFIRLMPLTLAGAMFVLINNVFLSFGEGSFFYSLGIR 67 Query: 67 QHFSA-------------VIGAVTSALAIYVTYNFAYSYVNRHEYNGHTAGLLSIASLLM 113 S V +++ + + + + AGLLS+A+ + Sbjct: 68 LDASTIETLNGLKGIGGNVYNGTLGIMSLMAPFFIGMALAEERKVDALAAGLLSVAAFMT 127 Query: 114 LMPQIITVPVVKNIPTEFPKSAVVDSVSNVEAFQTVYTGSTGLIVAIIIGFIVSLVYIQL 173 + P SV A + G +I IIIG +V+ ++ + Sbjct: 128 VTPY---------------------SVGEAYAVGANWLGGANIISGIIIGLVVAEMFTFI 166 Query: 174 SKRNLVIKLPAGVPPMVVDSLSPAIISMVIFCLMFGIRVGFSY--TPFHDIFNFSTQLIQ 231 +RN VIKLP VP V S S I +I +M I + T FH I + Sbjct: 167 VRRNWVIKLPDSVPASVSRSFSALIPGFIILSVMGIIAWALNTWGTNFHQIIMDTISTPL 226 Query: 232 APLTGAVANPWVLMGIFTFGNFLWFFGIHPNLI-----GGILNPLLLT-----MSYANID 281 A L V +V+ F LWFFGIH L GI+ P L Y +++ Sbjct: 227 ASLGSVVGWAYVI-----FVPLLWFFGIHGALALTALDNGIMTPWALENIATYQQYGSVE 281 Query: 282 A-YAAGKPV-----PYLQMMIVFAVGANAWGGSGNTYGLVISMFTAKSER-YKQLLKLGA 334 A AAGK P L I GGSG T GL++++F A Y+Q+ KL Sbjct: 282 AALAAGKTFHIWAKPMLDSFIFL-------GGSGATLGLILAIFIASRRADYRQVAKLAL 334 Query: 335 IPSIFNISEPLLFGLPMMLNPLFFIPLVFQPAILGTVALGLAKILYITNLNPMTALLPWT 394 IF I+EP+LFGLP+++NP+ FIP V IL + L Y+ + P+T + PWT Sbjct: 335 PSGIFQINEPILFGLPIIMNPVMFIPFVLVQPILAAITLA---AYYMGIIPPVTNIAPWT 391 Query: 395 TPAPVR--MAISGGLPFLIIFAICLVLNVLIYYPFFKVAYNKALEEEKAAVELEGSE 449 P + +G + L++ L + LIY PF VA NKA + A++ E SE Sbjct: 392 MPTGLGAFFNTNGSVAALLVALFNLGIATLIYLPFVVVA-NKA----QNAIDKEESE 443 Lambda K H 0.327 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 38 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 451 Length of database: 452 Length adjustment: 33 Effective length of query: 418 Effective length of database: 419 Effective search space: 175142 Effective search space used: 175142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory