Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate 16645 b2546 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)
Query= SwissProt::P37772 (331 letters) >FitnessBrowser__Keio:16645 Length = 332 Score = 166 bits (420), Expect = 8e-46 Identities = 105/306 (34%), Positives = 172/306 (56%), Gaps = 10/306 (3%) Query: 2 IKRNLPLMITIGVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGGI 61 + R++ + + V + YL PGF S N+L D A +GI A MT +I+SG I Sbjct: 20 VSRHINEIGLLVVIAILYLVFSLNAPGFISLNNQMNVLRDAATIGIAAWAMTLIIISGEI 79 Query: 62 DLSVGSVIAFTGVFLAKVIGDFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIITL 121 D+SVG ++AF V LA ++ F + +A LVL++G G G+L +P+F+ TL Sbjct: 80 DVSVGPMVAFVSVCLAFLL-QFEVPLAVACLLVLLLGALMGTLAGVLRGVFNVPSFVATL 138 Query: 122 AGMFFLRGVS-YLVSEESIPIN-HPIYDTLSSLAWKIPGGGRLSAMGLLMLAVVVIGIFL 179 LRG+ ++ + +PI+ + + D L +P L+M+ + + +F+ Sbjct: 139 GLWSALRGMGLFMTNALPVPIDENEVLDWLGGQFLGVP------VSALIMIVLFALFVFI 192 Query: 180 AHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALA 239 + +T FG V+A+GGNAT+A L GI+ R I I+ LS LA + GI+ + +G A A Sbjct: 193 SRKTAFGRSVFAVGGNATAAQLCGINVRRVRILIFTLSGLLAAVTGILLAARLGSGNAGA 252 Query: 240 GVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIGI 299 G+E D IA+VV+GGT LSGG G++ GTL GV + LI + G ++S++ ++ G+ Sbjct: 253 ANGLEFDVIAAVVVGGTALSGGRGSLFGTLLGVLVITLIGNGLVLLG-INSFFQQVVRGV 311 Query: 300 LLFIFI 305 ++ + + Sbjct: 312 IIVVAV 317 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 332 Length adjustment: 28 Effective length of query: 303 Effective length of database: 304 Effective search space: 92112 Effective search space used: 92112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory