Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate 16645 b2546 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__Keio:16645 Length = 332 Score = 156 bits (395), Expect = 6e-43 Identities = 104/299 (34%), Positives = 161/299 (53%), Gaps = 11/299 (3%) Query: 25 LVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILNRAAPVALLAIGMTLVIATGGIDL 84 LV + ++ LV SL AP F + + +++L AA + + A MTL+I +G ID+ Sbjct: 30 LVVIAILYLVFSLNAPGFISL--------NNQMNVLRDAATIGIAAWAMTLIIISGEIDV 81 Query: 85 SVGAVMAIAGATTAAMTVAGFSLPIVLLSALGTGILAGLWNGILVAILKIQPFVATLILM 144 SVG ++A A + L + L L G L G G+L + + FVATL L Sbjct: 82 SVGPMVAFVSVCLAFLLQFEVPLAVACLLVLLLGALMGTLAGVLRGVFNVPSFVATLGLW 141 Query: 145 VAGRGVAQLITAGQIVTFNSPD-LSWFGSGSLLFLPTPVIIAVLTLILFWLLTRKTALGM 203 A RG+ +T V + + L W G G L +P +I ++ LF ++RKTA G Sbjct: 142 SALRGMGLFMTNALPVPIDENEVLDWLG-GQFLGVPVSALIMIVLFALFVFISRKTAFGR 200 Query: 204 FIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGIIVAADIRGADANNAGLWLELD 263 + AVG N AA+ G+N R + +L + LSGL AA+ GI++AA + +A A LE D Sbjct: 201 SVFAVGGNATAAQLCGINVRRVRILIFTLSGLLAAVTGILLAARLGSGNAGAAN-GLEFD 259 Query: 264 AILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSGFPPEMNQVVKAVVVLCVLI 322 I AVV+GG +L GGR +L +++G L+I + G++L G QVV+ V+++ ++ Sbjct: 260 VIAAVVVGGTALSGGRGSLFGTLLGVLVITLIGNGLVLLGINSFFQQVVRGVIIVVAVL 318 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 332 Length adjustment: 28 Effective length of query: 313 Effective length of database: 304 Effective search space: 95152 Effective search space used: 95152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory