Align Probable 5-dehydro-4-deoxyglucarate dehydratase; EC 4.2.1.41; 5-keto-4-deoxy-glucarate dehydratase; KDGDH (uncharacterized)
to candidate 14406 b0268 2-keto-3-deoxy gluconate (KDG) aldolase; CP4-6 prophage (NCBI)
Query= curated2:A4YNH1 (314 letters) >FitnessBrowser__Keio:14406 Length = 302 Score = 95.9 bits (237), Expect = 1e-24 Identities = 91/298 (30%), Positives = 137/298 (45%), Gaps = 15/298 (5%) Query: 15 SGLLSFPVTPFKADYSFDETTYRSNMDWLCGYDVAGLFAAGGTGEFFSLTAAEVPEVVKV 74 +G++ T F AD D+ + +D L V GLF G GEF L A E + + Sbjct: 8 TGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIARF 67 Query: 75 AVDETKGRVPVLAGTGYGTAIAREIAMS--AEKAGADGLLLLPPYLMHAEQEGLAAHVEA 132 A+D RVPVL GTG GT I +S A++AGADG++++ PY + L + E Sbjct: 68 AIDHVDRRVPVLIGTG-GTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQ 126 Query: 133 VCKSVKIGVIVYN---RDNAILQPDTLARLCERCPNLVGYKDGIGDI-ELMTRVYTKMG- 187 V SV + V++YN L P + L + N++G KD I + L + ++T G Sbjct: 127 VADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKGA 186 Query: 188 -DRLTYIGGLPTAETFALPYLDMGVTTYSSAVFNFVPEFATNFYAAVRKRDHATIHAGLK 246 T + G + L +G SA NF P+ + N A R D A AG Sbjct: 187 HPHFTVLCGY---DDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKA-AGYH 242 Query: 247 DFILPLIAIRNRKKGYAVSIIKAGMKVIGRD-SGPVRLPLTDLTEAEMAELTALVKAL 303 +L + + + V++IK + + GR S V P + L E A+L L++ L Sbjct: 243 QTLLQIPQMYQLDTPF-VNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQL 299 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 302 Length adjustment: 27 Effective length of query: 287 Effective length of database: 275 Effective search space: 78925 Effective search space used: 78925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory