Align galactaro-1,5-lactonase (characterized)
to candidate 14892 b0767 6-phosphogluconolactonase (NCBI)
Query= reanno::HerbieS:HSERO_RS15795 (352 letters) >FitnessBrowser__Keio:14892 Length = 331 Score = 199 bits (507), Expect = 6e-56 Identities = 111/329 (33%), Positives = 178/329 (54%), Gaps = 7/329 (2%) Query: 21 YVSHADSQDIYVLRLNNDGSVNLIDKVDTGSTVMPLAISPDRKYLYASLRREPYAVASYA 80 Y++ +SQ I+V LN++G++ L VD V P+ +SPD++YLY +R E + V +Y Sbjct: 6 YIASPESQQIHVWNLNHEGALTLTQVVDVPGQVQPMVVSPDKRYLYVGVRPE-FRVLAYR 64 Query: 81 IDPASGKLKALSKAPLADNMANIATDRSGRYLLAASYFGNKISVNAIGSDGAVQTPPLAV 140 I P G L +++ L + +I+TD G+++ SY +SV + + + + V Sbjct: 65 IAPDDGALTFAAESALPGSPTHISTDHQGQFVFVGSYNAGNVSVTRL--EDGLPVGVVDV 122 Query: 141 IPTGKNAHSVQVDPANAFVFASNLGSDVILQYRFDPASGAVTPNTPPSVASKAGAGPRHF 200 + HS + P N ++ L D I + G + P V + GAGPRH Sbjct: 123 VEGLDGCHSANISPDNRTLWVPALKQDRICLFTVSD-DGHLVAQDPAEVTTVEGAGPRHM 181 Query: 201 VFSPDQRFLYCANELDATVSTYAYDRQAGTLTLLGSDSALPEGFQSSEQLAAADLHLTPD 260 VF P++++ YC NEL+++V + G + + + +PE F S+ AAD+H+TPD Sbjct: 182 VFHPNEQYAYCVNELNSSVDVWELKDPHGNIECVQTLDMMPENF--SDTRWAADIHITPD 239 Query: 261 GRFLYATERTSNTLTGYRVDRASGKLTRILNIPTETQPRAFNIDPQGRYLLAVGQKA-GL 319 GR LYA +RT++ +T + V L++ PTETQPR FN+D G+YL+A GQK+ + Sbjct: 240 GRHLYACDRTASLITVFSVSEDGSVLSKEGFQPTETQPRGFNVDHSGKYLIAAGQKSHHI 299 Query: 320 TSYAIDAASGTLTPLFRYTLGRNPNWVEI 348 + Y I G L RY +G+ P WV + Sbjct: 300 SVYEIVGEQGLLHEKGRYAVGQGPMWVVV 328 Lambda K H 0.316 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 26 Number of successful extensions: 10 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 331 Length adjustment: 29 Effective length of query: 323 Effective length of database: 302 Effective search space: 97546 Effective search space used: 97546 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory