Align TRAP-type small permease component (characterized, see rationale)
to candidate 17638 b3577 predicted transporter (NCBI)
Query= uniprot:Q930R3 (177 letters) >FitnessBrowser__Keio:17638 Length = 157 Score = 92.4 bits (228), Expect = 3e-24 Identities = 48/143 (33%), Positives = 82/143 (57%) Query: 10 KLLELLLIVLLAGMAVMVFLNVVLRYGFNSGINVSDEMSRYFFVWLTFIGAVVTFRENSH 69 K+LE +L + LA ++ +VF+N++LRYGF + I DE+SRY FVWLTFIGA+V F +N+H Sbjct: 3 KILEAILAINLAVLSCIVFINIILRYGFQTSILSVDELSRYLFVWLTFIGAIVAFMDNAH 62 Query: 70 VGVETLVSLFGRKGRIICMILSNIVVIAVSAIFFWGTWKQSPINASMAAPVTGISMLWVY 129 V V LV + ++++ +++ + WG ++ + S +P+ G+ + +Y Sbjct: 63 VQVTFLVEKLSPAWQRRVALVTHSLILFICGALAWGATLKTIQDWSDYSPILGLPIGLMY 122 Query: 130 GIGYFTGAGVVLIALERLVRLLT 152 T + L L +L+T Sbjct: 123 AACLPTSLVIAFFELRHLYQLIT 145 Lambda K H 0.329 0.141 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 64 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 177 Length of database: 157 Length adjustment: 18 Effective length of query: 159 Effective length of database: 139 Effective search space: 22101 Effective search space used: 22101 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory