Align N-Acetyl-D-glucosamine ABC transport system, permease component 2 (characterized)
to candidate 15432 b1312 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)
Query= reanno::Phaeo:GFF2752 (280 letters) >FitnessBrowser__Keio:15432 Length = 280 Score = 137 bits (345), Expect = 3e-37 Identities = 84/270 (31%), Positives = 141/270 (52%), Gaps = 15/270 (5%) Query: 19 LITYTLIALFPVFVILVNSFK-TRKAIFRDPLGLPTSDTFSLVGYQTVLKQG--DFFLYF 75 L + +I LFP FV+L+ SFK ++AI P LP ++L Y + F YF Sbjct: 17 LALFLIITLFPFFVMLMTSFKGAKEAISLHPTLLPQQ--WTLEHYVDIFNPMIFPFVDYF 74 Query: 76 QNSMIVTVVSLALVLLFGAMAAFALAEYRFKGNMLLG-----LYLALGIMIPIRIGTVAI 130 +NS++V+VVS + + G + A+AL+ RFKG M + +Y+ GI++ V + Sbjct: 75 RNSLVVSVVSSVVAVFLGILGAYALSRLRFKGRMTINASFYTVYMFSGILL-----VVPL 129 Query: 131 LELMVDTGLVNTLTALILVYTAQGLPLAVFILSEFMKQVSDDLKNAGRIDGLSEYTIFFR 190 +++ G+ +T ALI+ Q LP AVF+L + + D+++ A +DGL+ I FR Sbjct: 130 FKIITALGIYDTEMALIITMVTQTLPTAVFMLKSYFDTIPDEIEEAAMMDGLNRLQIIFR 189 Query: 191 LVLPLVRPAMATVAVFNMIPIWNDLWFPLILAPAEETKTLTLGSQVFIGQFVTDWNAVLS 250 + +PL + +V V+ + WND F I + TL +G W +++ Sbjct: 190 ITVPLAMSGLISVFVYCFMVAWNDYLFASIFLSSASNFTLPVGLNALFSTPDYIWGRMMA 249 Query: 251 ALSMAILPVMVLYVIFSRQLIRGITSGAVK 280 A + LPV+++Y + R + G+T+G VK Sbjct: 250 ASLVTALPVVIMYALSERFIKSGLTAGGVK 279 Lambda K H 0.330 0.143 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 280 Length adjustment: 26 Effective length of query: 254 Effective length of database: 254 Effective search space: 64516 Effective search space used: 64516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory