GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagPcb in Escherichia coli BW25113

Align PTS system N-acetylglucosamine-specific EIICB component; EIICB-Nag; EC 2.7.1.- (characterized)
to candidate 14809 b0679 fused N-acetyl glucosamine specific PTS enzyme: IIC, IIB , and IIA components (NCBI)

Query= SwissProt::O34521
         (452 letters)



>lcl|FitnessBrowser__Keio:14809 b0679 fused N-acetyl glucosamine
           specific PTS enzyme: IIC, IIB , and IIA components
           (NCBI)
          Length = 648

 Score =  474 bits (1219), Expect = e-138
 Identities = 234/465 (50%), Positives = 316/465 (67%), Gaps = 15/465 (3%)

Query: 1   MLSFLQKLGKSFMLPIAVLPAVGIILALGREDVFNIPFVYQAGTAVFDHLPLIFAIGIAI 60
           +L F Q+LG++  LPIAVLP   ++L  G+ D+ N+ F+ QAG A+FD+L LIFAIG+A 
Sbjct: 3   ILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAGGAIFDNLALIFAIGVAS 62

Query: 61  GISKDSNGAAGLSGAISYLMLDAATKTIDKTNNMAVFGGIIAGLIAGYTYNRFKDTKLPE 120
             SKDS GAA L+GA+ Y +L  A  TI+   NM V  GII GL+ G  YNR+ D KLP+
Sbjct: 63  SWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIITGLVGGAAYNRWSDIKLPD 122

Query: 121 YLGFFSGRRLVPILTAIITIILAGIFGVVWPPIQSCINSFGEWMLGLGGIGAGIFGLFNR 180
           +L FF G+R VPI T    ++LA IFG VWPP+Q  I++ GEW++  G +G+GIFG  NR
Sbjct: 123 FLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINR 182

Query: 181 LLIPLGLHHVLNNIFWFQFGEYNGVT-----GDLARFFAKDPTAGTYMTGFFPIMMFGLP 235
           LLIP GLH VLN I WFQ GE+         GD+ RF+A D TAG +M+GFFPIMMFGLP
Sbjct: 183 LLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAGDGTAGMFMSGFFPIMMFGLP 242

Query: 236 AACLAMVVTAKPSKRKATAGMMIGFALTAFITGITEPIEFAFMFLSPLLYAVHAVLTGLS 295
            A LAM   A   +R    GM++  A+TAF+TG+TEP+EF FMFL+PLLY +HA+LTG+S
Sbjct: 243 GAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLAPLLYLLHALLTGIS 302

Query: 296 LFIVNWLGIRSGFSFSAGAIDYVLSYGI---AEKPLLLLLVGICYAAVYFIVFYVLIKAL 352
           LF+   LGI +GFSFSAGAIDY L Y +   ++   +LL++G+ + A+YF+VF ++I+  
Sbjct: 303 LFVATLLGIHAGFSFSAGAIDYALMYNLPAASQNVWMLLVMGVIFFAIYFVVFSLVIRMF 362

Query: 353 NLKTPGREDDDVDEVLDENTVQDVNENI------MLKGLGGKENLQTIDHCATRLRLTVK 406
           NLKTPGRED + DE++ E    +  E +       +  +GG +NL+ ID C TRLRLTV 
Sbjct: 363 NLKTPGREDKE-DEIVTEEANSNTEEGLTQLATNYIAAVGGTDNLKAIDACITRLRLTVA 421

Query: 407 DTALVDEALLKKAGAKGVVKSGGQSVQVIIGPNVEFAAEELRAAV 451
           D+A V++ + K+ GA GVVK   Q++QVI+G   E   + ++  V
Sbjct: 422 DSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESIGDAMKKVV 466


Lambda     K      H
   0.326    0.144    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 762
Number of extensions: 41
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 452
Length of database: 648
Length adjustment: 35
Effective length of query: 417
Effective length of database: 613
Effective search space:   255621
Effective search space used:   255621
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory