GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ptsC in Escherichia coli BW25113

Align IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) (characterized)
to candidate 15742 b1621 fused maltose and glucose-specific PTS enzymes: IIB component -! IIC component (NCBI)

Query= TCDB::Q8GBT6
         (403 letters)



>lcl|FitnessBrowser__Keio:15742 b1621 fused maltose and
           glucose-specific PTS enzymes: IIB component -! IIC
           component (NCBI)
          Length = 530

 Score =  229 bits (585), Expect = 1e-64
 Identities = 145/424 (34%), Positives = 231/424 (54%), Gaps = 44/424 (10%)

Query: 5   QRIGRSLMLPVAVLPAAALLVRLGNA----------DMLGRPEFPAFVTKIAGFMAAGGN 54
           Q++G++ MLPVA+L    +++ +G++           +LG P   A  T    +M+  G+
Sbjct: 16  QQLGKTFMLPVALLSFCGIMLGIGSSLSSHDVITLIPVLGNPVLQAIFT----WMSKIGS 71

Query: 55  AILDNMALLFAVGIAIGFAKKSDGSTALAAVVGYLVFKNVLATF--TDKNL-----PQVA 107
                + ++F + I +G A+++ G  A A  +GY V  N+   F  T+K +       V 
Sbjct: 72  FAFSFLPVMFCIAIPLGLARENKGVAAFAGFIGYAVM-NLAVNFWLTNKGILPTTDAAVL 130

Query: 108 KAVDGKVVMVDAPVDAKVLGGVVMGLVVALLYQRFYRTKLPDWAGFFGGRRLVPILSAFA 167
           KA + + ++    +D  +LG V+ G++V +L++RF+  +LPD   FFGG R VPI+S+  
Sbjct: 131 KANNIQSILGIQSIDTGILGAVIAGIIVWMLHERFHNIRLPDALAFFGGTRFVPIISSLV 190

Query: 168 GLVIGIVFGYIWPVLGTGLHNFGEWLVGSGAVGAGIFGVANRALIPIGMHHLLNSFPWF- 226
             ++G+V   +WP+   G+   G  +  +G  G  +FG   R L+P G+HH+L +   F 
Sbjct: 191 MGLVGLVIPLVWPIFAMGISGLGHMINSAGDFGPMLFGTGERLLLPFGLHHILVALIRFT 250

Query: 227 QAG---EYEGK--SGDIARFLAG---------DPTAGQFMT-GFFPIMMFALPAACLAIV 271
            AG   E  G+  SG +  F A            +A +F++ G  P  +  LP A LA+ 
Sbjct: 251 DAGGTQEVCGQTVSGALTIFQAQLSCPTTHGFSESATRFLSQGKMPAFLGGLPGAALAMY 310

Query: 272 HCARPERRKVVGGMMFSLALTSFVTGVTEPIEFTFMFIAPVLYAIHAVLTGVSMALTWAL 331
           HCARPE R  + G++ S  +   V G TEP+EF F+F+APVLY IHA+LTG+   +   L
Sbjct: 311 HCARPENRHKIKGLLISGLIACVVGGTTEPLEFLFLFVAPVLYVIHALLTGLGFTVMSVL 370

Query: 332 GMKDGFGFSAGAVDFFLNLGI---ASNPWGLA-LVGVCFAALYYVVFRFAITKFNLPTPG 387
           G+    G + G +  F+  GI    S  W +  +V   +  +YYV+FRFAIT+FNL TPG
Sbjct: 371 GVT--IGNTDGNIIDFVVFGILHGLSTKWYMVPVVAAIWFVVYYVIFRFAITRFNLKTPG 428

Query: 388 RESD 391
           R+S+
Sbjct: 429 RDSE 432


Lambda     K      H
   0.328    0.143    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 672
Number of extensions: 37
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 403
Length of database: 530
Length adjustment: 33
Effective length of query: 370
Effective length of database: 497
Effective search space:   183890
Effective search space used:   183890
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory