Align Glucose-6-P:Pi antiporter, Hpt (may also transport other organophosphates including C3 organophosphates) (characterized)
to candidate 17727 b3667 regulator of uhpT (VIMSS)
Query= TCDB::Q9Z7N9 (455 letters) >FitnessBrowser__Keio:17727 Length = 439 Score = 434 bits (1117), Expect = e-126 Identities = 203/440 (46%), Positives = 290/440 (65%), Gaps = 10/440 (2%) Query: 7 FFQPPKHIKEIEDQEVVKKKYKYWRIRIFYSMFIGYIFYYFTRKSFTFAMPTLIADLGFD 66 F + P + D+ + +Y+YWR I ++++GY +YFTRKSF A+P ++A+ Sbjct: 4 FLKAPADAPLMTDKYEIDARYRYWRRHILLTIWLGYALFYFTRKSFNAAVPEILANGVLS 63 Query: 67 KAQLGIIGSTLYFSYGISKFVSGVMSDQSNPRYFMAIGLMITGLTNIFFGMSSSIVLFAL 126 ++ +G++ + Y +YG+SKFVSG++SD+SN RYFM IGL+ TG+ NI FG S+S+ FA+ Sbjct: 64 RSDIGLLATLFYITYGVSKFVSGIVSDRSNARYFMGIGLIATGIINILFGFSTSLWAFAV 123 Query: 127 WWGLNGWFQGWGWPPCARLLTHWYAKSERGTWWSVWSTSHNIGGALIPILTGFIIDYSGW 186 W LN +FQGWG P CARLLT WY+++ERG WW++W+T+HN+GGALIPI+ + GW Sbjct: 124 LWVLNAFFQGWGSPVCARLLTAWYSRTERGGWWALWNTAHNVGGALIPIVMAAAALHYGW 183 Query: 187 RGAMYVPGILCIGMGLVLINRLRDTPQSLGLPPIEKYKRDPHHAHHEGKSASEGTEEIER 246 R M + G + I +G+ L RLRD PQ+LGLP + +++ D + + A Sbjct: 184 RAGMMIAGCMAIVVGIFLCWRLRDRPQALGLPAVGEWRHDALEIAQQQEGAG-------- 235 Query: 247 ELSTREILFTYVLTNQWLWFLAAASFFIYIVRMAVNDWSALFLIETKHYAAVKANFCVSL 306 L+ +EIL YVL N ++W L+ +Y+VR A+NDW L++ ET V AN V++ Sbjct: 236 -LTRKEILTKYVLLNPYIWLLSFCYVLVYVVRAAINDWGNLYMSETLGVDLVTANTAVTM 294 Query: 307 FEIGGLFGMLVAGWLSDKISKGNRGPMNVLFSLGLLFAILGMWFSRSHNQWWVDGTLLFV 366 FE+GG G LVAGW SDK+ GNRGPMN++F+ G+L ++ +W + + T F Sbjct: 295 FELGGFIGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLWL-MPFASYVMQATCFFT 353 Query: 367 IGFFLYGPQMMIGLAAAELSHKKAAGTASGFTGWFAYFGATFAGYPLGKVTDVWGWKGFF 426 IGFF++GPQM+IG+AAAE SHK+AAG A+GF G FAY GA+ AG+PL KV D W W GFF Sbjct: 354 IGFFVFGPQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASLAGWPLAKVLDTWHWSGFF 413 Query: 427 IALLACASIALLLFLPTWNA 446 + + A I+ LL LP NA Sbjct: 414 VVISIAAGISALLLLPFLNA 433 Lambda K H 0.327 0.141 0.476 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 874 Number of extensions: 54 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 439 Length adjustment: 33 Effective length of query: 422 Effective length of database: 406 Effective search space: 171332 Effective search space used: 171332 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory