Align 3-carboxymuconate cyclase-like protein (characterized, see rationale)
to candidate 14892 b0767 6-phosphogluconolactonase (NCBI)
Query= uniprot:Q39EM3 (349 letters) >FitnessBrowser__Keio:14892 Length = 331 Score = 161 bits (408), Expect = 2e-44 Identities = 109/352 (30%), Positives = 168/352 (47%), Gaps = 34/352 (9%) Query: 6 RPTVVVSNAADGDLSTFSLAADGTLAPLARYPAADVAMPIAVQADRARLYVATRGEQPTI 65 + TV +++ + ++L +G L P+ V D+ LYV R E + Sbjct: 2 KQTVYIASPESQQIHVWNLNHEGALTLTQVVDVPGQVQPMVVSPDKRYLYVGVRPEF-RV 60 Query: 66 VAFRVVPATGALVRIGTTAIDASHAYLSLDRSGRWLLGASYGGNSLSLYDAAHVRDGDGT 125 +A+R+ P GAL +A+ S ++S D G+++ SY ++S+ R DG Sbjct: 61 LAYRIAPDDGALTFAAESALPGSPTHISTDHQGQFVFVGSYNAGNVSV-----TRLEDGL 115 Query: 126 PL---QVASGIANAHSVIVSPDNRFAYVSSLGSDRVFSFALVEDAAGLRALEHGETRVPT 182 P+ V G+ HS +SPDNR +V +L DR+ F V D L A + E Sbjct: 116 PVGVVDVVEGLDGCHSANISPDNRTLWVPALKQDRICLFT-VSDDGHLVAQDPAEVTTVE 174 Query: 183 GFGPRHLQFADDGRALVVVSEFEATLATFTRDPDTGRLGDAHVSARHPAVAELAQGHARP 242 G GPRH+ F + + V+E +++ D L D H + E Q Sbjct: 175 GAGPRHMVFHPNEQYAYCVNELNSSV-------DVWELKDPHGNI------ECVQTLDMM 221 Query: 243 PAPTEPSVWAADLHLTPDERFAYVSERTSSRLLCYRRGEDGT------FEPAHATATETQ 296 P + WAAD+H+TPD R Y +RT+S + + EDG+ F+P TETQ Sbjct: 222 PENFSDTRWAADIHITPDGRHLYACDRTASLITVFSVSEDGSVLSKEGFQP-----TETQ 276 Query: 297 PRGFAIDPSGRWLVACGEQSEYVSVYAIAPDDGALSPHARVPGGRGANWVAI 348 PRGF +D SG++L+A G++S ++SVY I + G L R G+G WV + Sbjct: 277 PRGFNVDHSGKYLIAAGQKSHHISVYEIVGEQGLLHEKGRYAVGQGPMWVVV 328 Lambda K H 0.318 0.133 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 28 Number of successful extensions: 11 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 349 Length of database: 331 Length adjustment: 28 Effective length of query: 321 Effective length of database: 303 Effective search space: 97263 Effective search space used: 97263 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory