Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate 15057 b0933 alkanesulfonate transporter subunit (NCBI)
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >FitnessBrowser__Keio:15057 Length = 255 Score = 157 bits (396), Expect = 3e-43 Identities = 92/232 (39%), Positives = 134/232 (57%), Gaps = 13/232 (5%) Query: 24 LQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRVLLDGAPVEGPGAERGMVF 83 L +D + FV ++G SG GKSTLLR++AGL+ T+G VL P+ + M+F Sbjct: 27 LNQLDLHIPAGQFVAVVGRSGGGKSTLLRLLAGLETPTAGDVLAGTTPLAEIQEDTRMMF 86 Query: 84 QSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGLRGFEQHFPKQLSGGMQQR 143 Q L PW ++ N+ GL+ Q ++ A +A VGL +P LSGG +QR Sbjct: 87 QDARLLPWKSVIDNVGLGLK------GQWRDAARRALAAVGLENRAGEWPAALSGGQKQR 140 Query: 144 TAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAERKTVLFVTHDIDEAIFMA 203 A+ARAL + P +LL+DEP GALD TR+ MQ+L++ +W+ TVL VTHD+ EA+ MA Sbjct: 141 VALARALIHRPGLLLLDEPLGALDALTRLEMQDLIVSLWQEHGFTVLLVTHDVSEAVAMA 200 Query: 204 NRVAVFSARPGRIKTELAVDLPHPRHYTIKTSPEFMDLKARLTEEI--RAES 253 +RV + G+I +L VD+P PR S +L+A + + + R ES Sbjct: 201 DRVLLI--EEGKIGLDLTVDIPRPRRL---GSVRLAELEAEVLQRVMQRGES 247 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 255 Length adjustment: 24 Effective length of query: 235 Effective length of database: 231 Effective search space: 54285 Effective search space used: 54285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory