Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate 16032 b1918 predicted transporter subunit: membrane component of ABC superfamily (NCBI)
Query= uniprot:B2TBJ8 (250 letters) >FitnessBrowser__Keio:16032 Length = 222 Score = 133 bits (335), Expect = 3e-36 Identities = 80/228 (35%), Positives = 121/228 (53%), Gaps = 9/228 (3%) Query: 1 MHFDFDFLFDTIKQLLAAVPTTLGLFFCSLILGGLLSLVIVTMRVSPHWLPNRFARAYIL 60 M + D++ LL TL L + G LL ++ MR+SP W AR YI Sbjct: 1 MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYIS 60 Query: 61 VFRGSPLLIQMFLVYYGMGQFGVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGGL 120 +FRG+PL+ Q+F++YYG+ QFG+ + P A++ L+L TA Y AE +R + Sbjct: 61 IFRGTPLIAQLFMIYYGLPQFGIELD---------PIPSAMIGLSLNTAAYAAETLRAAI 111 Query: 121 MAVPVGQIEAGYSIGLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEV 180 ++ GQ EA SIG++ + +RR I P A R LP S + LVK T+LA+ + V E+ Sbjct: 112 SSIDKGQWEAAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPEL 171 Query: 181 TGVAQQIIQQTYRTTEVFICAALIYLFLNFVIVRLLGMLETRLSRHLR 228 AQ I +T +++ A+LIY + V+ L E +L+R R Sbjct: 172 FRQAQLITSRTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQER 219 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 222 Length adjustment: 23 Effective length of query: 227 Effective length of database: 199 Effective search space: 45173 Effective search space used: 45173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory