Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate 15634 b1513 fused AI2 transporter subunits of ABC superfamily: ATP-binding components (NCBI)
Query= TCDB::P73650 (240 letters) >FitnessBrowser__Keio:15634 Length = 511 Score = 114 bits (285), Expect = 4e-30 Identities = 72/226 (31%), Positives = 122/226 (53%), Gaps = 3/226 (1%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 LL + V+ Y + V +L+GI+F++ GE+ ++G NGAGKSTL K I G+ G + Sbjct: 11 LLCARSVYKQY-SGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITPADSGTLE 69 Query: 64 FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIYTMF 123 +G N L + G+ VPQ +F SL++ EN+ G Q Q +K+ + + Sbjct: 70 IEGNNYVRLTPVHAHQLGIYLVPQEPLLFPSLSIKENILFGLAKKQLSMQKMKNLLAALG 129 Query: 124 PKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAIN 183 + + AG+L +RQM+ + R LM D +L+LDEP+A+L+P + +F++++ + Sbjct: 130 CQFDL--HSLAGSLDVADRQMVEILRGLMRDSRILILDEPTASLTPAETERLFSRLQELL 187 Query: 184 ATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLV 229 ATG I+ + + +ADR V+ +G L G L D ++ Sbjct: 188 ATGVGIVFISHKLPEIRQIADRISVMRDGTIALSGKTSELSTDDII 233 Score = 86.3 bits (212), Expect = 1e-21 Identities = 55/200 (27%), Positives = 105/200 (52%), Gaps = 9/200 (4%) Query: 22 QGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENITGLGSDQIVRRG 81 + ++ ++ GE++ + G GAG++ LA+T++GL T G I+ G+ I L + + + RG Sbjct: 280 RNVSLTLNAGEILGLAGLVGAGRTELAETLYGLRTLRGGRIMLNGKEINKLSTGERLLRG 339 Query: 82 MCYVPQVCNVFG-SLTVAENLDMGAFLHQGP---TQTLKDRIYTMFPKLA-----QRRNQ 132 + Y+P+ G +L + ++ A H +T KD + A + Q Sbjct: 340 LVYLPEDRQSSGLNLDASLAWNVCALTHNLRGFWAKTAKDNATLERYRRALNIKFNQPEQ 399 Query: 133 RAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAINATGKAIILV 192 A TLSGG +Q + + + L P +L++DEP+ + D++ +++I A A++L+ Sbjct: 400 AARTLSGGNQQKILIAKCLEASPQVLIVDEPTRGVDVSARNDIYQLLRSIAAQNVAVLLI 459 Query: 193 EQNAKQALMMADRGYVLENG 212 + ++ +MADR YV+ G Sbjct: 460 SSDLEEIELMADRVYVMHQG 479 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 240 Length of database: 511 Length adjustment: 29 Effective length of query: 211 Effective length of database: 482 Effective search space: 101702 Effective search space used: 101702 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory