GapMind for catabolism of small carbon sources

 

Aligments for a candidate for natE in Escherichia coli BW25113

Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate 17516 b3455 leucine/isoleucine/valine transporter subunit (NCBI)

Query= TCDB::P73650
         (240 letters)



>lcl|FitnessBrowser__Keio:17516 b3455 leucine/isoleucine/valine
           transporter subunit (NCBI)
          Length = 255

 Score =  114 bits (284), Expect = 2e-30
 Identities = 75/245 (30%), Positives = 126/245 (51%), Gaps = 22/245 (8%)

Query: 11  FAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENIT 70
           F G +A    +  +N  + P E+V++IGPNGAGK+T+   + G   P+ G I+ + +++ 
Sbjct: 15  FGGLLA----VNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILLRDQHLE 70

Query: 71  GLGSDQIVRRGMCYVPQVCNVFGSLTVAENL------DMGAFLHQGPTQT---------L 115
           GL   QI R G+    Q   +F  +TV ENL       +   L  G  +T          
Sbjct: 71  GLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSFRRAQSEA 130

Query: 116 KDRIYTMFPK--LAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVK 173
            DR  T   +  L +  N++A  L+ G+++ L + R ++  P++L+LDEP+A L+P   K
Sbjct: 131 LDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGLNPKETK 190

Query: 174 DVFAQIKAI-NATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGEL 232
           ++   I  + N     I+L+E + K  + ++DR YV+  G     G+ + + N+P V   
Sbjct: 191 ELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIRNNPDVIRA 250

Query: 233 YLGAA 237
           YLG A
Sbjct: 251 YLGEA 255


Lambda     K      H
   0.320    0.139    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 141
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 240
Length of database: 255
Length adjustment: 24
Effective length of query: 216
Effective length of database: 231
Effective search space:    49896
Effective search space used:    49896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory