Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate 17516 b3455 leucine/isoleucine/valine transporter subunit (NCBI)
Query= TCDB::P73650 (240 letters) >FitnessBrowser__Keio:17516 Length = 255 Score = 114 bits (284), Expect = 2e-30 Identities = 75/245 (30%), Positives = 126/245 (51%), Gaps = 22/245 (8%) Query: 11 FAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENIT 70 F G +A + +N + P E+V++IGPNGAGK+T+ + G P+ G I+ + +++ Sbjct: 15 FGGLLA----VNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILLRDQHLE 70 Query: 71 GLGSDQIVRRGMCYVPQVCNVFGSLTVAENL------DMGAFLHQGPTQT---------L 115 GL QI R G+ Q +F +TV ENL + L G +T Sbjct: 71 GLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSFRRAQSEA 130 Query: 116 KDRIYTMFPK--LAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVK 173 DR T + L + N++A L+ G+++ L + R ++ P++L+LDEP+A L+P K Sbjct: 131 LDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGLNPKETK 190 Query: 174 DVFAQIKAI-NATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGEL 232 ++ I + N I+L+E + K + ++DR YV+ G G+ + + N+P V Sbjct: 191 ELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIRNNPDVIRA 250 Query: 233 YLGAA 237 YLG A Sbjct: 251 YLGEA 255 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 255 Length adjustment: 24 Effective length of query: 216 Effective length of database: 231 Effective search space: 49896 Effective search space used: 49896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory