Align short-chain acyl-CoA dehydrogenase monomer (EC 1.3.8.1) (characterized)
to candidate 15814 b1695 putative oxidoreductase (VIMSS)
Query= metacyc::MONOMER-17424 (375 letters) >FitnessBrowser__Keio:15814 Length = 383 Score = 182 bits (463), Expect = 1e-50 Identities = 121/377 (32%), Positives = 198/377 (52%), Gaps = 9/377 (2%) Query: 3 VNDEQQQIADAVRAFAQERL-KPFAEQWDKDHRFPKEAIDEMAELGLFGMLVPEQWGGSD 61 + +EQ+ + ++R + + D++ +P+E + +A+ G+ + VPE++GG Sbjct: 5 LTEEQELLLASIRELITTNFPEEYFRTCDQNGTYPREFMRALADNGISMLGVPEEFGGIP 64 Query: 62 TGYVAYAMALEEIAAGDGACSTIMSVHNSVGCVPILR-FGN-EQQKEQFLTPLATGAMLG 119 YV +AL E++ C + + C+ +R FG+ EQ ++ + L TG Sbjct: 65 ADYVTQMLALMEVSK----CGAPAFLITNGQCIHSMRRFGSAEQLRKTAESTLETGDPAY 120 Query: 120 AFALTEPQAGSDASSLKTRARLEGDHYVLNGSKQFITSGQNAGVVIVFAVT-DPEAGKRG 178 A ALTEP AGSD +S T + +NG K FIT + ++V A P+ K+ Sbjct: 121 ALALTEPGAGSDNNSATTTYTRKNGKVYINGQKTFITGAKEYPYMLVLARDPQPKDPKKA 180 Query: 179 ISAFIVPTDSPGYQVARVEDKLGQHASDTCQIVFDNVQVPVANRLGAEGEGYKIALANLE 238 + + V + PG ++ + K+G H TC++ DNV+V ++ +G EG G+ + N E Sbjct: 181 FTLWWVDSSKPGIKINPLH-KIGWHMLSTCEVYLDNVEVEESDMVGEEGMGFLNVMYNFE 239 Query: 239 GGRIGIASQAVGMARAAFEVARDYANERQSFGKPLIEHQAVAFRLADMATKISVARQMVL 298 R+ A+++ G A AFE A YAN+R +FGKP+ +Q + +LA MA KI R MVL Sbjct: 240 MERLINAARSTGFAECAFEDAARYANQRIAFGKPIGHNQMIQEKLALMAIKIDNMRNMVL 299 Query: 299 HAAALRDAGRPALVEASMAKLFASEMAEKVCSDALQTLGGYGYLSDFPLERIYRDVRVCQ 358 A D + A++AKL+ + A +V DA+Q +GG GY + + R +RDVR + Sbjct: 300 KVAWQADQHQSLRTSAALAKLYCARTAMEVIDDAIQIMGGLGYTDEARVSRFWRDVRCER 359 Query: 359 IYEGTSDIQRMVIARNL 375 I GT +I V R + Sbjct: 360 IGGGTDEIMIYVAGRQI 376 Lambda K H 0.319 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 383 Length adjustment: 30 Effective length of query: 345 Effective length of database: 353 Effective search space: 121785 Effective search space used: 121785 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory