Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate 14261 b0115 dihydrolipoamide acetyltransferase (NCBI)
Query= reanno::Smeli:SMc03203 (426 letters) >lcl|FitnessBrowser__Keio:14261 b0115 dihydrolipoamide acetyltransferase (NCBI) Length = 630 Score = 228 bits (582), Expect = 3e-64 Identities = 147/435 (33%), Positives = 223/435 (51%), Gaps = 45/435 (10%) Query: 6 IKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVG 65 + +PD+G E E+ E VK GD V + L V DKA++E+P+P G V L VG Sbjct: 209 VNVPDIGGD--EVEVTEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVG 266 Query: 66 DTVAVKAPLVRIETAGEAGEAAPDSIPEALAEQVLDEPVAVSSRLEAKAP-PQPEKPAPK 124 D V + ++ E G A AAP ++ EA AP P + AP Sbjct: 267 DKVKTGSLIMIFEVEGAAPAAAP-------------------AKQEAAAPAPAAKAEAPA 307 Query: 125 PAPAPR-----EAPDLSAKPLASPAVRLRARESGIDLRQVAGTGPAGRITHEDLDLFISR 179 APA + E + A A+P +R ARE G++L +V GTG GRI ED+ ++ Sbjct: 308 AAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKE 367 Query: 180 G---AEPLPAQTG-------------LVRKTAVEEVRMIGLRRRIAEKMSLSTSRIPHIT 223 AE PA TG + +EEV + +++ +S + IPH+T Sbjct: 368 AIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPHVT 427 Query: 224 YVEEVDMTALEDLRATMNRD--RKPEQAKLTILPFLMRALVKTVAEQPGVNATFDDHAGV 281 + ++ D+T LE R N + ++ K+T + F+M+A+ + + P N++ + Sbjct: 428 HFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLSEDGQR 487 Query: 282 IHRHAAVHIGIATQTPAGLTVPVVRHAEARGIWDCAAELNRLADAARTGTATRDELTGST 341 + ++IG+A TP GL VPV + +GI + + EL ++ AR G T E+ G Sbjct: 488 LTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGEMQGGC 547 Query: 342 ITISSLGAIGGIASTPVINHPEVAIVGVNKIAVRPVWDGAQFVPRKIMNLSSSFDHRVID 401 TISS+G +G P++N PEVAI+GV+K A+ PVW+G +FVPR ++ +S SFDHRVID Sbjct: 548 FTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLSFDHRVID 607 Query: 402 GWDAAVFVQRLKTLL 416 G D A F+ + L Sbjct: 608 GADGARFITIINNTL 622 Score = 58.2 bits (139), Expect = 7e-13 Identities = 45/142 (31%), Positives = 65/142 (45%), Gaps = 26/142 (18%) Query: 6 IKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVG 65 IK+PD+G E E+ E VK GD V + L V DKA++E+PSP G V + VG Sbjct: 5 IKVPDIGAD--EVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVSVG 62 Query: 66 DTVAVKAPLVRIETAGEAGEAAPDSIPEALAEQVLDEPVAVSSRLEAKAPPQPEKPAPKP 125 D A ++ ++A A +AAP A AE + ++ AP Sbjct: 63 DKTQTGALIMIFDSADGAADAAP-----AQAE-------------------EKKEAAPAA 98 Query: 126 APAPREAPDLSAKPLASPAVRL 147 APA A D++ + S V + Sbjct: 99 APAAAAAKDVNVPDIGSDEVEV 120 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 627 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 3 Length of query: 426 Length of database: 630 Length adjustment: 35 Effective length of query: 391 Effective length of database: 595 Effective search space: 232645 Effective search space used: 232645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory