Align acetyl-CoA C-acetyltransferase (EC 2.3.1.16) (characterized)
to candidate 16925 b2844 putative acyltransferase (VIMSS)
Query= metacyc::MONOMER-20831 (393 letters) >lcl|FitnessBrowser__Keio:16925 b2844 putative acyltransferase (VIMSS) Length = 393 Score = 530 bits (1364), Expect = e-155 Identities = 257/392 (65%), Positives = 327/392 (83%), Gaps = 1/392 (0%) Query: 1 MQDVVIVAATRTAVGSFQGSLASIPAPELGAAVIRRLLEQTGLDPAQVDEVILGQVLTAG 60 M+DVVIV A RT +G F+G+LA A ELG+ V++ L+E+TG+ VDEVILGQVLTAG Sbjct: 1 MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG 60 Query: 61 SGQNPARQASILAGLPHAVPSLTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSL 120 +GQNPARQ++I GLP++V ++T+N VCGSGLKALHL QAI+CG+A+++IAGG ENMS Sbjct: 61 AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR 120 Query: 121 APYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA 180 AP+VL +RTG ++G+++++DS++ DGLWDAFNDYH+G+TAENL +YGISR+ QDA+A Sbjct: 121 APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL 180 Query: 181 ASQQKATAAIEAGRFVDEITPILIPQRKGDPVAFAVDEQPRAGTTAESLAKLKPAFKKDG 240 +SQQKA AAI+AGRF DEI P++ Q G + DEQPR +AE LA+L P+F G Sbjct: 181 SSQQKARAAIDAGRFKDEIVPVMT-QSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLG 239 Query: 241 SVTAGNASSLNDGAAAVLLMSADKAKALGLPVLARIASYANAGVDPAIMGIGPVSATRRC 300 SVTAGNASS+NDGAAAV++MS KA+AL LPVLARI ++A+ GVDPA+MGI PV ATRRC Sbjct: 240 SVTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRC 299 Query: 301 LDKAGWSLGDLDLIEANEAFAAQSLAVGKELEWDAEKVNVNGGAIAIGHPIGASGCRVLV 360 L++ GW L ++DLIEANEAFAAQ+L+VGK LEWD +VNVNGGAIA+GHPIGASGCR+LV Sbjct: 300 LERVGWQLAEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILV 359 Query: 361 TLLHEMIKRDAKKGLATLCIGGGQGVALALER 392 +L+HEM+KR+A+KGLATLCIGGGQGVAL +ER Sbjct: 360 SLVHEMVKRNARKGLATLCIGGGQGVALTIER 391 Lambda K H 0.317 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 393 Length adjustment: 31 Effective length of query: 362 Effective length of database: 362 Effective search space: 131044 Effective search space used: 131044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 16925 b2844 (putative acyltransferase (VIMSS))
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.12533.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-145 468.8 6.1 7.5e-145 468.6 6.1 1.0 1 lcl|FitnessBrowser__Keio:16925 b2844 putative acyltransferase ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Keio:16925 b2844 putative acyltransferase (VIMSS) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 468.6 6.1 7.5e-145 7.5e-145 1 385 [] 6 390 .. 6 390 .. 0.99 Alignments for each domain: == domain 1 score: 468.6 bits; conditional E-value: 7.5e-145 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaaglpesvpaltv 79 iv+a+Rtpig ++g+l+ sa++L++ v+k+l+er+g+ + ++devilG+vl+ag+++n+aR+ a++ glp+sv+a+t+ lcl|FitnessBrowser__Keio:16925 6 IVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAGAGQNPARQSAIKGGLPNSVSAITI 84 89********99******************************************************************* PP TIGR01930 80 nrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdl...vktklsmgetA 155 n vC+Sgl+A++la q+i++Gead+v+aGG E+mSr+p++l +s r +++lg+++l d+l++d+ + ++++ g+tA lcl|FitnessBrowser__Keio:16925 85 NDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLTDS--RTGAQLGNSQLVDSLVHDGlwdAFNDYHIGVTA 161 ******************************************98..89********************99********* PP TIGR01930 156 enlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk..kkvvskDegirpnttlekLakLkpafkekkg 232 enla++ygisR+ qD+yal+S+qka +Ai++g+fkdeivpv + + + vv++De++r + ++e La+L+p f++ g lcl|FitnessBrowser__Keio:16925 162 ENLAREYGISRQLQDAYALSSQQKARAAIDAGRFKDEIVPVMTQSNgqTLVVDTDEQPRTDASAEGLARLNPSFDS-LG 239 *****************************************9999999999***********************96.89 PP TIGR01930 233 stvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinE 311 s vtAgN+s++nDGAaa+++mse++a++l+l +lari+++a +gvdp+ mg++pv+A++++L++ g+++ ++dl+E nE lcl|FitnessBrowser__Keio:16925 240 S-VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCLERVGWQLAEVDLIEANE 317 7.***************************************************************************** PP TIGR01930 312 AFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 AFAaq+l v k l+ d+ +vNvnGGAiAlGHP+GasG+ri+++l++e+ +r+++ GlatlC+ggGqG+A+ +e lcl|FitnessBrowser__Keio:16925 318 AFAAQALSVGKMLE-WDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRNARKGLATLCIGGGQGVALTIE 390 **************.88*****************************************************9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.89 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory