Align acetyl-CoA C-acetyltransferase (EC 2.3.1.16) (characterized)
to candidate 16925 b2844 putative acyltransferase (VIMSS)
Query= metacyc::MONOMER-20831 (393 letters) >FitnessBrowser__Keio:16925 Length = 393 Score = 530 bits (1364), Expect = e-155 Identities = 257/392 (65%), Positives = 327/392 (83%), Gaps = 1/392 (0%) Query: 1 MQDVVIVAATRTAVGSFQGSLASIPAPELGAAVIRRLLEQTGLDPAQVDEVILGQVLTAG 60 M+DVVIV A RT +G F+G+LA A ELG+ V++ L+E+TG+ VDEVILGQVLTAG Sbjct: 1 MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG 60 Query: 61 SGQNPARQASILAGLPHAVPSLTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSL 120 +GQNPARQ++I GLP++V ++T+N VCGSGLKALHL QAI+CG+A+++IAGG ENMS Sbjct: 61 AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR 120 Query: 121 APYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA 180 AP+VL +RTG ++G+++++DS++ DGLWDAFNDYH+G+TAENL +YGISR+ QDA+A Sbjct: 121 APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL 180 Query: 181 ASQQKATAAIEAGRFVDEITPILIPQRKGDPVAFAVDEQPRAGTTAESLAKLKPAFKKDG 240 +SQQKA AAI+AGRF DEI P++ Q G + DEQPR +AE LA+L P+F G Sbjct: 181 SSQQKARAAIDAGRFKDEIVPVMT-QSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLG 239 Query: 241 SVTAGNASSLNDGAAAVLLMSADKAKALGLPVLARIASYANAGVDPAIMGIGPVSATRRC 300 SVTAGNASS+NDGAAAV++MS KA+AL LPVLARI ++A+ GVDPA+MGI PV ATRRC Sbjct: 240 SVTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRC 299 Query: 301 LDKAGWSLGDLDLIEANEAFAAQSLAVGKELEWDAEKVNVNGGAIAIGHPIGASGCRVLV 360 L++ GW L ++DLIEANEAFAAQ+L+VGK LEWD +VNVNGGAIA+GHPIGASGCR+LV Sbjct: 300 LERVGWQLAEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILV 359 Query: 361 TLLHEMIKRDAKKGLATLCIGGGQGVALALER 392 +L+HEM+KR+A+KGLATLCIGGGQGVAL +ER Sbjct: 360 SLVHEMVKRNARKGLATLCIGGGQGVALTIER 391 Lambda K H 0.317 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 393 Length adjustment: 31 Effective length of query: 362 Effective length of database: 362 Effective search space: 131044 Effective search space used: 131044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 16925 b2844 (putative acyltransferase (VIMSS))
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.24794.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-145 468.8 6.1 7.5e-145 468.6 6.1 1.0 1 lcl|FitnessBrowser__Keio:16925 b2844 putative acyltransferase ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Keio:16925 b2844 putative acyltransferase (VIMSS) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 468.6 6.1 7.5e-145 7.5e-145 1 385 [] 6 390 .. 6 390 .. 0.99 Alignments for each domain: == domain 1 score: 468.6 bits; conditional E-value: 7.5e-145 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaaglpesvpaltv 79 iv+a+Rtpig ++g+l+ sa++L++ v+k+l+er+g+ + ++devilG+vl+ag+++n+aR+ a++ glp+sv+a+t+ lcl|FitnessBrowser__Keio:16925 6 IVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAGAGQNPARQSAIKGGLPNSVSAITI 84 89********99******************************************************************* PP TIGR01930 80 nrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdl...vktklsmgetA 155 n vC+Sgl+A++la q+i++Gead+v+aGG E+mSr+p++l +s r +++lg+++l d+l++d+ + ++++ g+tA lcl|FitnessBrowser__Keio:16925 85 NDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLTDS--RTGAQLGNSQLVDSLVHDGlwdAFNDYHIGVTA 161 ******************************************98..89********************99********* PP TIGR01930 156 enlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk..kkvvskDegirpnttlekLakLkpafkekkg 232 enla++ygisR+ qD+yal+S+qka +Ai++g+fkdeivpv + + + vv++De++r + ++e La+L+p f++ g lcl|FitnessBrowser__Keio:16925 162 ENLAREYGISRQLQDAYALSSQQKARAAIDAGRFKDEIVPVMTQSNgqTLVVDTDEQPRTDASAEGLARLNPSFDS-LG 239 *****************************************9999999999***********************96.89 PP TIGR01930 233 stvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinE 311 s vtAgN+s++nDGAaa+++mse++a++l+l +lari+++a +gvdp+ mg++pv+A++++L++ g+++ ++dl+E nE lcl|FitnessBrowser__Keio:16925 240 S-VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCLERVGWQLAEVDLIEANE 317 7.***************************************************************************** PP TIGR01930 312 AFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 AFAaq+l v k l+ d+ +vNvnGGAiAlGHP+GasG+ri+++l++e+ +r+++ GlatlC+ggGqG+A+ +e lcl|FitnessBrowser__Keio:16925 318 AFAAQALSVGKMLE-WDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRNARKGLATLCIGGGQGVALTIE 390 **************.88*****************************************************9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.87 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory