Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate 16525 b2426 putative oxidoreductase (VIMSS)
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >FitnessBrowser__Keio:16525 Length = 263 Score = 157 bits (397), Expect = 2e-43 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%) Query: 18 RLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKA 77 +L K L+TGA QGIGE I FA A L++ DI E +E +A RG A+ A Sbjct: 3 KLTGKTALITGALQGIGEGIARTFARHGANLILLDISPE-IEKLADELCGRGHRCTAVVA 61 Query: 78 DVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGC 137 DV + + A + A E+ GRID+LVN AGV L+M+++D I++ G W Sbjct: 62 DVRDPASVAAAIKRAKEKEGRIDILVNNAGVCRLGSFLDMSDDDRDFHIDINIKGVWNVT 121 Query: 138 KAVLPQMIEQGVGSIINIASTHSSHII-PGCFPYPVAKHGLLGLTRALGIEYAPKGVRVN 196 KAVLP+MI + G I+ ++S + PG Y + K ++GLT++L +EYA G+RVN Sbjct: 122 KAVLPEMIARKDGRIVMMSSVTGDMVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRVN 181 Query: 197 AIAPGYIETQL--NVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPF 254 AI PGY+ T + ++ + DP + P RR+ P+EV A FLASDE+ + Sbjct: 182 AICPGYVRTPMAESIARQSNPEDPESVLTEMAKAIPMRRLADPLEVGELAAFLASDESSY 241 Query: 255 INASCITIDGGRSV 268 + + IDGG ++ Sbjct: 242 LTGTQNVIDGGSTL 255 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 263 Length adjustment: 25 Effective length of query: 247 Effective length of database: 238 Effective search space: 58786 Effective search space used: 58786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory