Align 6-phosphofructokinase (EC 2.7.1.11) (characterized)
to candidate 16277 b2168 1-phosphofructokinase (NCBI)
Query= BRENDA::P06999 (309 letters) >FitnessBrowser__Keio:16277 Length = 312 Score = 105 bits (261), Expect = 2e-27 Identities = 92/286 (32%), Positives = 131/286 (45%), Gaps = 6/286 (2%) Query: 3 RIYTLTLAPSLDSATITPQIYPEGKLRCTAPV-FEPGGGGINVARAIAHLGGSATAIFPA 61 R+ T+TL P+ D P+I G++ G GINVA+ + LG T Sbjct: 4 RVATITLNPAYDLVGFCPEI-ERGEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGGFL 62 Query: 62 GGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQL 121 G + L ++ + + TR N+ + E GE F G + ++ + Sbjct: 63 GKDNQDGFQQLFSELGIANRFQVVQGRTRINVKL-TEKDGEVTDFNFSGFEVTPADWERF 121 Query: 122 EEQVLE-IESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGN 180 L + ++ +SGSLP GV E T ++ + Q I DSS EAL A L Sbjct: 122 VTDSLSWLGQFDMVCVSGSLPSGVSPEAFTDWMTRLRSQCPCIIFDSSREALVAGLKAAP 181 Query: 181 IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ 240 LVKPN++EL R+L + DV +AA + G A VV+SLG +GAL V++ Sbjct: 182 W-LVKPNRRELEIWAGRKLPEMKDVIEAAHALREQGIA-HVVISLGAEGALWVNASGEWI 239 Query: 241 VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAA 286 PP V STVGAGDSMVG + L S E +R A + A Sbjct: 240 AKPPSVDVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALA 285 Lambda K H 0.314 0.131 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 312 Length adjustment: 27 Effective length of query: 282 Effective length of database: 285 Effective search space: 80370 Effective search space used: 80370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory