Align ABC transporter for Lactose, permease component 1 (characterized)
to candidate 15431 b1311 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)
Query= reanno::Smeli:SM_b21653 (298 letters) >FitnessBrowser__Keio:15431 Length = 293 Score = 114 bits (286), Expect = 2e-30 Identities = 83/272 (30%), Positives = 132/272 (48%), Gaps = 18/272 (6%) Query: 18 LFVAPALGLITLFMVYPIAWSLWMSFQS---GRGMTLKFAGFANIVRLWNDPVFIKALTN 74 L +AP+L L+ + +P+ ++ +SF + F G +N VR+ +DP F +L Sbjct: 16 LLLAPSLLLLGGLVAWPMVSNIEISFLRLPLNPNIESTFVGVSNYVRILSDPGFWHSLWM 75 Query: 75 TMTYFVVQVPIMILLALILASLLNNP---RLVGRGVFRTAIFLPCVSSLVAYSVLFKGMF 131 T+ Y + V +L L +A N R R + + P +S + A+ +F + Sbjct: 76 TVWYTALVVAGSTVLGLAVAMFFNREFRLRKTARSLVILSYVTPSISLVFAWKYMFNNGY 135 Query: 132 ATDGIVNST-LQAIGLAASPIPWLTHPFWAKVLVILAITWRWTGYNMIFYLAALQNIDKS 190 GIVN + + L W +P + VLV+L WR+ Y I +LA LQ IDKS Sbjct: 136 ---GIVNYLGVDLLHLYEQAPLWFDNPGSSFVLVVLFAIWRYFPYAFISFLAILQTIDKS 192 Query: 191 IYEVARIDGVPAWARLTHLTIPLLKPVILFTTVISTIGTLQLFDEVYNLTEGKGGPSNAT 250 +YE A +DG AW R +T+P + PV+ + TI +F +VY LT Sbjct: 193 LYEAAEMDGANAWQRFRIVTLPAIMPVLATVVTLRTIWMFYMFADVYLLT-------TKV 245 Query: 251 LTLSLYIYNLTFRFMPNLGYAATVSYVIVVLV 282 L +Y+Y F F +LG AA +S V+ +++ Sbjct: 246 DILGVYLYKTAFAF-NDLGKAAAISVVLFIII 276 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 293 Length adjustment: 26 Effective length of query: 272 Effective length of database: 267 Effective search space: 72624 Effective search space used: 72624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory