GapMind for catabolism of small carbon sources

 

Aligments for a candidate for amaB in Escherichia coli BW25113

Align Alpha-aminoadipic semialdehyde dehydrogenase; Alpha-AASA dehydrogenase; Aldehyde dehydrogenase family 7 member A1; Antiquitin-1; Betaine aldehyde dehydrogenase; Delta1-piperideine-6-carboxylate dehydrogenase; P6c dehydrogenase; EC 1.2.1.31; EC 1.2.1.3; EC 1.2.1.8 (characterized)
to candidate 16751 b2661 succinate-semialdehyde dehydrogenase I, NADP-dependent (NCBI)

Query= SwissProt::Q64057
         (539 letters)



>lcl|FitnessBrowser__Keio:16751 b2661 succinate-semialdehyde
           dehydrogenase I, NADP-dependent (NCBI)
          Length = 482

 Score =  231 bits (588), Expect = 6e-65
 Identities = 142/469 (30%), Positives = 238/469 (50%), Gaps = 10/469 (2%)

Query: 52  EGVFNGSW--GGRGEVITTYCPANNEPIARVRQASMKDYEETIGKAKKAWNIWADIPAPK 109
           + + NG W     GE I    PAN + +  V +    +    I  A +A   W  + A +
Sbjct: 12  QALINGEWLDANNGEAIDVTNPANGDKLGSVPKMGADETRAAIDAANRALPAWRALTAKE 71

Query: 110 RGEIVRKIGDALREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTL 169
           R  I+R   + + E    L RL++LE GK L E  GE+       ++ A   + I G T+
Sbjct: 72  RATILRNWFNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFAEEGKRIYGDTI 131

Query: 170 PSERPGHALMEQWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSIA 229
           P  +    L+    P+G+   IT +NFP A+       AL  G   + K A  T   ++A
Sbjct: 132 PGHQADKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSALA 191

Query: 230 VTKIIAKVLEDNLLPGAICSLTCGGAD-MGTAMARDERVNLLSFTGSTQVGKQVALMVQE 288
           + ++  +      +P  + ++  G A  +G  +  +  V  LSFTGST++G+Q+     +
Sbjct: 192 LAELAIRAG----VPAGVFNVVTGSAGAVGNELTSNPLVRKLSFTGSTEIGRQLMEQCAK 247

Query: 289 RFGKSLLELGGNNAIIAFEDADLSLVLPSALFAAVGTAGQRCTTVRRLFLHESIHDEVVD 348
              K  LELGGN   I F+DADL   +  AL +    AGQ C    RL++ + ++D   +
Sbjct: 248 DIKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQDGVYDRFAE 307

Query: 349 RLKNAYSQIRVGNPWDPNILYGPLHTKQAVSMFVQAVEEAKKEGGTVVYGGKVMDHPGNY 408
           +L+ A S++ +G+  D  +  GPL  ++AV+   + + +A ++G  VV GGK  +  GN+
Sbjct: 308 KLQQAVSKLHIGDGLDNGVTIGPLIDEKAVAKVEEHIADALEKGARVVCGGKAHERGGNF 367

Query: 409 VEPTIVTGLVHDAPIVHKETFAPILYVFKFKNEEEVFEWNNEVKQGLSSSIFTKDLGRIF 468
            +PTI+  +  +A +  +ETF P+  +F+FK+E +V    N+ + GL++  + +DL R+F
Sbjct: 368 FQPTILVDVPANAKVSKEETFGPLAPLFRFKDEADVIAQANDTEFGLAAYFYARDLSRVF 427

Query: 469 RWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYM 517
           R +G +  + GIV +N      E+   FGG K +G GRE      + Y+
Sbjct: 428 R-VG-EALEYGIVGINTGIISNEV-APFGGIKASGLGREGSKYGIEDYL 473


Lambda     K      H
   0.319    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 609
Number of extensions: 29
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 539
Length of database: 482
Length adjustment: 34
Effective length of query: 505
Effective length of database: 448
Effective search space:   226240
Effective search space used:   226240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory