Align butyryl-CoA dehydrogenase; EC 1.3.99.2 (characterized)
to candidate 14185 b0039 crotonobetaine reductase subunit II, FAD-binding (NCBI)
Query= CharProtDB::CH_091787 (383 letters) >FitnessBrowser__Keio:14185 Length = 380 Score = 171 bits (433), Expect = 3e-47 Identities = 114/384 (29%), Positives = 184/384 (47%), Gaps = 8/384 (2%) Query: 1 MDFNLTDIQQDFLKLAHDF-GEKKLAPTVTERDHKGIYDKELIDELLSLGITGAYFEEKY 59 MDFNL D Q+ F+ + + E D +Y + + L +GI E++ Sbjct: 1 MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKALADMGIDSLLIPEEH 60 Query: 60 GGSGDDGGDVLSYILAVEELAKYDAGVAITLSATVSLCANPIWQFGTEAQKEKFLVPLVE 119 GG D G L+ + EL + A + N + GT+ Q +K + Sbjct: 61 GGL-DAGFVTLAAVWM--ELGRLGAPTYVLYQLPGGF--NTFLREGTQEQIDKIMAFRGT 115 Query: 120 GTKLGAFGLTEPNAGTDASGQQTIATKNDDGTYTLNGSKIFITNGGAADIYIVFAMTDKS 179 G ++ +TEP AG+D +T T+ + Y LNGSK FIT+ +V A S Sbjct: 116 GKQMWNSAITEPGAGSDVGSLKTTYTRRNGKIY-LNGSKCFITSSAYTPYIVVMARDGAS 174 Query: 180 KGNHGITAFILEDGTPGFTYGKKEDKMGIHTSQTMELVFQDVKVPAENMLGEEGKGFKIA 239 T + ++ PG K E K+G+ E+ F DV++ ++M G EG GF Sbjct: 175 PDKPVYTEWFVDMSKPGIKVTKLE-KLGLRMDSCCEITFDDVELDEKDMFGREGNGFNRV 233 Query: 240 MMTLDGGRIGVAAQALGIAEAALADAVEYSKQRVQFGKPLCKFQSISFKLADMKMQIEAA 299 D R VA G A A DA Y+ QRVQFG+ + +FQ I K A M +++ + Sbjct: 234 KEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQEKFAHMAIKLNSM 293 Query: 300 RNLVYKAACKKQEGKPFTVDAAIAKRVASDVAMRVTTEAVQIFGGYGYSEEYPVARHMRD 359 +N++Y+AA K G + DAA+ K ++ A V A+Q+ GG G + + ++R RD Sbjct: 294 KNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVGIAGNHRISRFWRD 353 Query: 360 AKITQIYEGTNEVQLMVTGGALLR 383 ++ ++ G++E+Q++ G A+L+ Sbjct: 354 LRVDRVSGGSDEMQILTLGRAVLK 377 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 380 Length adjustment: 30 Effective length of query: 353 Effective length of database: 350 Effective search space: 123550 Effective search space used: 123550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory