Align butyryl-CoA dehydrogenase; EC 1.3.99.2 (characterized)
to candidate 15814 b1695 putative oxidoreductase (VIMSS)
Query= CharProtDB::CH_091787 (383 letters) >FitnessBrowser__Keio:15814 Length = 383 Score = 172 bits (436), Expect = 1e-47 Identities = 125/390 (32%), Positives = 192/390 (49%), Gaps = 19/390 (4%) Query: 1 MDFNLTDIQQDFLK-----LAHDFGEKKLAPTVTERDHKGIYDKELIDELLSLGITGAYF 55 MDF+LT+ Q+ L + +F E+ D G Y +E + L GI+ Sbjct: 1 MDFSLTEEQELLLASIRELITTNFPEEYFRTC----DQNGTYPREFMRALADNGISMLGV 56 Query: 56 EEKYGGSGDDGGDVLSYILAVEELAKYDAGVAITLSATVSLCANPIWQFGTEAQKEKFLV 115 E++GG D ++ +LA+ E++K A + T C + + +FG+ Q K Sbjct: 57 PEEFGGIP---ADYVTQMLALMEVSKCGAPAFLI---TNGQCIHSMRRFGSAEQLRKTAE 110 Query: 116 PLVE-GTKLGAFGLTEPNAGTDASGQQTIATKNDDGTYTLNGSKIFITNGGAADIYIVFA 174 +E G A LTEP AG+D + T T+ + Y +NG K FIT +V A Sbjct: 111 STLETGDPAYALALTEPGAGSDNNSATTTYTRKNGKVY-INGQKTFITGAKEYPYMLVLA 169 Query: 175 MTDKSKG-NHGITAFILEDGTPGFTYGKKEDKMGIHTSQTMELVFQDVKVPAENMLGEEG 233 + K T + ++ PG K+G H T E+ +V+V +M+GEEG Sbjct: 170 RDPQPKDPKKAFTLWWVDSSKPGIKINPLH-KIGWHMLSTCEVYLDNVEVEESDMVGEEG 228 Query: 234 KGFKIAMMTLDGGRIGVAAQALGIAEAALADAVEYSKQRVQFGKPLCKFQSISFKLADMK 293 GF M + R+ AA++ G AE A DA Y+ QR+ FGKP+ Q I KLA M Sbjct: 229 MGFLNVMYNFEMERLINAARSTGFAECAFEDAARYANQRIAFGKPIGHNQMIQEKLALMA 288 Query: 294 MQIEAARNLVYKAACKKQEGKPFTVDAAIAKRVASDVAMRVTTEAVQIFGGYGYSEEYPV 353 ++I+ RN+V K A + + + AA+AK + AM V +A+QI GG GY++E V Sbjct: 289 IKIDNMRNMVLKVAWQADQHQSLRTSAALAKLYCARTAMEVIDDAIQIMGGLGYTDEARV 348 Query: 354 ARHMRDAKITQIYEGTNEVQLMVTGGALLR 383 +R RD + +I GT+E+ + V G +L+ Sbjct: 349 SRFWRDVRCERIGGGTDEIMIYVAGRQILK 378 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 383 Length adjustment: 30 Effective length of query: 353 Effective length of database: 353 Effective search space: 124609 Effective search space used: 124609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory