GapMind for catabolism of small carbon sources

 

Aligments for a candidate for cadA in Escherichia coli BW25113

Align Lysine decarboxylase LdcA; EC 4.1.1.18 (characterized)
to candidate 14824 b0693 ornithine decarboxylase isozyme, inducible (NCBI)

Query= SwissProt::Q9I2S7
         (751 letters)



>lcl|FitnessBrowser__Keio:14824 b0693 ornithine decarboxylase
           isozyme, inducible (NCBI)
          Length = 732

 Score =  367 bits (941), Expect = e-105
 Identities = 239/676 (35%), Positives = 345/676 (51%), Gaps = 36/676 (5%)

Query: 93  LPIFALGEQVTIENAPAESMADLHQLRGILYLFEDTVPFLARQVARAARNYLAGLLPPFF 152
           +P+F   E    E  PAE    L ++ G+    E    F  RQ+  AA +Y   L PPFF
Sbjct: 58  IPVFIATENQ--ERVPAEY---LPRISGVFENCESRREFYGRQLETAASHYETQLRPPFF 112

Query: 153 RALVEHTAQSNYSWHTPGHGGGVAYRKSPVGQAFHQFFGENTLRSDLSVSVPELGSLLDH 212
           RALV++  Q N ++  PGH GG  +R+ P G  F ++FGE   R+DL  +   +G LL H
Sbjct: 113 RALVDYVNQGNSAFDCPGHQGGEFFRRHPAGNQFVEYFGEALFRADLCNADVAMGDLLIH 172

Query: 213 TGPLAEAEDRAARNFGADHTFFVINGTSTANKIVWHSMVGREDLVLVDRNCHKSILH-SI 271
            G    A+  AA+ F AD T+FV+NGTS++NK+V ++++   DLVL DRN HKS  H ++
Sbjct: 173 EGAPCIAQQHAAKVFNADKTYFVLNGTSSSNKVVLNALLTPGDLVLFDRNNHKSNHHGAL 232

Query: 272 IMTGAIPLYLTPERNELGIIGPIPLSEFSKQSIAAKIAASPLARGREPK-VKLAVVTNST 330
           +  GA P+YL   RN  G IG I    F +  +   IA     R +E +  +LAV+   T
Sbjct: 233 LQAGATPVYLETARNPYGFIGGIDAHCFEESYLRELIAEVAPQRAKEARPFRLAVIQLGT 292

Query: 331 YDGLCYNAELIKQTLGDSVEVLHFDEAWYAYAAFHEFYDGRYGMGTSRSEEGPLVFATHS 390
           YDG  YNA  +   +G   + + FD AW  Y  F         +    +E  P +  T S
Sbjct: 293 YDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMADCSPLLLDLNENDPGILVTQS 352

Query: 391 THKMLAAFSQASMIHVQD----GGTRKLDVARFNEAFMMHISTSPQYGIIASLDVASAMM 446
            HK  A FSQ S IH +D    G  R +   R N AFMMH STSP Y + A+L++ + M 
Sbjct: 353 VHKQQAGFSQTSQIHKKDSHIKGQQRYVPHKRMNNAFMMHASTSPFYPLFAALNINAKMH 412

Query: 447 EGPAGRSLIQETFDEALSFRRALANVRQNLDRNDWWFGVWQPEQVEG-------TDQVGT 499
           EG +GR++  +     ++ R+ + +  Q++         + PE V+G       T Q+  
Sbjct: 413 EGVSGRNMWMDCVVNGINARKLILDNCQHI-------RPFVPELVDGKPWQSYETAQIAV 465

Query: 500 --HDWVLEPSADWHGFGDIAEDYVLLDPIKVTLTTPGLSA-GGKLSEQGIPAAIVSRFLW 556
               +   P   WH F   AE+   +DP K+ LTTPG+ A  G+    G+PA I++ FL 
Sbjct: 466 DLRFFQFVPGEHWHSFEGYAENQYFVDPCKLLLTTPGIDARNGEYEAFGVPATILANFLR 525

Query: 557 ERGLVVEKTGLYSFLVLFSMGITKGKWSTLVTELLEFKRCYDANLPLLDVLPSVAQAGGK 616
           E G+V EK  L S L L +      K   LV  L+ F++  +++ PL +VLPS+ +   +
Sbjct: 526 ENGVVPEKCDLNSILFLLTPAEDMAKLQQLVALLVRFEKLLESDAPLAEVLPSIYKQHEE 585

Query: 617 RYNGVGLRDLSDAMHASYRDNATAKAMKRMYTV--LPEVAMRPSEAYDKLVRGEVEAVPI 674
           RY G  LR L   MH  Y  +   +  K M+     P V+M P EA    +RGEVE V +
Sbjct: 586 RYAGYTLRQLCQEMHDLYARHNVKQLQKEMFRKEHFPRVSMNPQEANYAYLRGEVELVRL 645

Query: 675 ARLEGRIAAVMLVPYPPGIPLIMPGERFTEATRSILDYLEFARTFERAFPGFDSDVHGL- 733
              EGRIAA   +PYPPG+  ++PGE +  A   +L Y           PGF  ++ G+ 
Sbjct: 646 PDAEGRIAAEGALPYPPGVLCVVPGEIWGGA---VLRYFSALEEGINLLPGFAPELQGVY 702

Query: 734 --QHQDGPSGRCYTVE 747
             +H       CY ++
Sbjct: 703 IEEHDGRKQVWCYVIK 718


Lambda     K      H
   0.320    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1201
Number of extensions: 58
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 751
Length of database: 732
Length adjustment: 40
Effective length of query: 711
Effective length of database: 692
Effective search space:   492012
Effective search space used:   492012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory