Align lysine 2,3-aminomutase (EC 5.4.3.2) (characterized)
to candidate 18174 b4146 predicted lysine aminomutase (NCBI)
Query= BRENDA::G3F9W8 (439 letters) >FitnessBrowser__Keio:18174 Length = 342 Score = 185 bits (469), Expect = 2e-51 Identities = 120/336 (35%), Positives = 170/336 (50%), Gaps = 13/336 (3%) Query: 20 DAPQWRDWRWQIAHTVRSLSMLEKVLGITFPPEEREKLQETIDKFPLAATPYYLSLIKTE 79 + P DW Q+A V L ++L I + EKL L A S I Sbjct: 8 NTPSREDWLTQLADVVTDPDELLRLLNI----DAEEKLLAGRSAKKLFALRVPRSFIDRM 63 Query: 80 DYAN--DPIFRQAVPVPDELRVEECELEDPLAEDSDSPVPGITHRYPDRVLFLVSNVCAM 137 + N DP+ RQ + DE + DPL E+ S VPG+ H+Y +R L LV CA+ Sbjct: 64 EKGNPDDPLLRQVLTSQDEFVIAPGFSTDPL-EEQHSVVPGLLHKYHNRALLLVKGGCAV 122 Query: 138 YCRHCTRKR--KVGDRDRIPTWEEMEVGITYIREHPEVRDVLLSGGDPLMLPDDLLDRIL 195 CR+C R+ ++ W+ + Y+ HPE+ +++ SGGDPLM D LD +L Sbjct: 123 NCRYCFRRHFPYAENQGNKRNWQ---TALEYVAAHPELDEMIFSGGDPLMAKDHELDWLL 179 Query: 196 TQLRAIPHVEVIRIGSRTPVVLPFRITDGLVNVLKKHQ-PIWLNTHFNHPQEITPSAEKA 254 TQL AIPH++ +RI SR P+V+P RIT+ LV + I L H NH E+ + +A Sbjct: 180 TQLEAIPHIKRLRIHSRLPIVIPARITEALVECFARSTLQILLVNHINHANEVDETFRQA 239 Query: 255 LAKLADAGIPLGNQSVLLAGVNDCPRIMKSLVQKLVKNRVRPYYLYQCDLSEGLSHFRTP 314 +AKL G+ L NQSVLL VND + + +L L V PYYL+ D +G +HF Sbjct: 240 MAKLRRVGVTLLNQSVLLRDVNDNAQTLANLSNALFDAGVMPYYLHVLDKVQGAAHFMVS 299 Query: 315 VGKGIEIMENLIGHTSGFAVPTYVIDAPGGGGKIPV 350 + +IM L+ SG+ VP + G K P+ Sbjct: 300 DDEARQIMRELLTLVSGYLVPKLAREIGGEPSKTPL 335 Lambda K H 0.319 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 342 Length adjustment: 30 Effective length of query: 409 Effective length of database: 312 Effective search space: 127608 Effective search space used: 127608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory