Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate 14450 b0312 betaine aldehyde dehydrogenase, NAD-dependent (NCBI)
Query= BRENDA::P77674 (474 letters) >FitnessBrowser__Keio:14450 Length = 490 Score = 328 bits (841), Expect = 2e-94 Identities = 184/481 (38%), Positives = 275/481 (57%), Gaps = 13/481 (2%) Query: 2 QHKLLINGELVSG-EGEKQPVYNPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTP 60 + +L I+G S G NPA G+VL + A E VD AV++A W T Sbjct: 6 EQQLYIHGGYTSATSGRTFETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWASMTA 65 Query: 61 KVRAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNG 120 R+ L + D++ E A+LE+ + GK +I DV ++AG L G Sbjct: 66 MERSRILRRAVDILRERNDELAKLETLDTGKAYSETSTVDIVTGADVLEYYAGLIPALEG 125 Query: 121 LAAGEYLEGHTSMI--RRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITP 178 + TS + RR+PLGVVA I WNYP+ +A WK APALAAGN ++ KPSE+TP Sbjct: 126 ---SQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTP 182 Query: 179 LTALKLAELAKDI-FPAGVINILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTA 237 LTALKLAE+ + P GV N+L G G G LT HP + VS TG +A+G+ +++++A Sbjct: 183 LTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEHPGIAKVSFTGGVASGKKVMANSA 242 Query: 238 -SSIKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTL 296 SS+K MELGGK+P+IVFDDAD++ + ++++GQ CT R++ Sbjct: 243 ASSLKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFSSGQVCTNGTRVFVPAKCKAAF 302 Query: 297 VEKLGAAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVITGGEKRKGN 356 +K+ A V +++G D T GPL S H + V + + + K G +V+ GG+ KG+ Sbjct: 303 EQKILARVERIRAGDVFDPQTNFGPLVSFPHRDNVLRYIAKGKEEG-ARVLCGGDVLKGD 361 Query: 357 GY----YYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWT 412 G+ + APT+ D IV++E+FGPV+S+ +++E++V+ AND+ YGLA+ + T Sbjct: 362 GFDNGAWVAPTVFTDCSDDMTIVREEIFGPVMSILTYESEDEVIRRANDTDYGLAAGIVT 421 Query: 413 KDVGRAHRVSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMV 472 D+ RAHRV +L+ G W+NT +EMP GG K SG G++ + L+ YT V+ + V Sbjct: 422 ADLNRAHRVIHQLEAGICWINTWGESPAEMPVGGYKHSGIGRENGVMTLQSYTQVKSIQV 481 Query: 473 K 473 + Sbjct: 482 E 482 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 490 Length adjustment: 34 Effective length of query: 440 Effective length of database: 456 Effective search space: 200640 Effective search space used: 200640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory