Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate 14400 b0262 putative ATP-binding component of a transport system (VIMSS)
Query= reanno::Smeli:SMc03065 (362 letters) >FitnessBrowser__Keio:14400 Length = 348 Score = 224 bits (571), Expect = 3e-63 Identities = 123/287 (42%), Positives = 186/287 (64%), Gaps = 11/287 (3%) Query: 6 LKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDGE 65 L+++ K +G+ VI I+L I +G+ V +GPSGCGK+T+LR++AGLE+ + G +FIDGE Sbjct: 9 LRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSEGQIFIDGE 68 Query: 66 RVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQLTP 125 V +R I MVFQSYAL+PHM++ +N+ +G+++ + E+ RV+ A M+ L Sbjct: 69 DVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLKMLGVPRAELKARVKEALAMVDLEG 128 Query: 126 YLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSERMSD 185 + DR +SGGQ+QRVA+ RA+ PKV LFDEPLSNLDA LR + R +I +L ++ D Sbjct: 129 FEDRFVDQISGGQQQRVALARALILKPKVLLFDEPLSNLDANLRRSMRDKIREL-QKQFD 187 Query: 186 TTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAMNVIPA 245 T +YVTHDQ EA ++D ++V++ GHI Q+G+P +LY +PA+ F+A F+G N+ PA Sbjct: 188 ITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQDLYRQPASRFMASFMGD--ANLFPA 245 Query: 246 TITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTE 292 T + V + G L P + G+ GVRPE + +++ Sbjct: 246 TFS----DGYVDIYG---YHLPRPLHFGTQGE-GMVGVRPEAITLSD 284 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 348 Length adjustment: 29 Effective length of query: 333 Effective length of database: 319 Effective search space: 106227 Effective search space used: 106227 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory