GapMind for catabolism of small carbon sources

 

Aligments for a candidate for malEIICBA in Escherichia coli BW25113

Align The maltose/maltotriose porter, MalT (31% identical to 4.A.1.1.9) (characterized)
to candidate 15742 b1621 fused maltose and glucose-specific PTS enzymes: IIB component -! IIC component (NCBI)

Query= TCDB::Q8DS05
         (729 letters)



>lcl|FitnessBrowser__Keio:15742 b1621 fused maltose and
           glucose-specific PTS enzymes: IIB component -! IIC
           component (NCBI)
          Length = 530

 Score =  229 bits (584), Expect = 3e-64
 Identities = 175/555 (31%), Positives = 282/555 (50%), Gaps = 53/555 (9%)

Query: 10  FEFWQKFGKCLMVVIAVMPAAGLMVSIGNSLALIDPKSTLLVTVANIIAQ--------IG 61
           +EF+Q+ GK  M+ +A++   G+M+ IG+SL+  D   TL+  + N + Q        IG
Sbjct: 12  WEFFQQLGKTFMLPVALLSFCGIMLGIGSSLSSHDV-ITLIPVLGNPVLQAIFTWMSKIG 70

Query: 62  WGVINNLHILFAVAIGGSWAKERAG-GAFAAALAFILINLITGNFYGISLEMIADKTSYV 120
               + L ++F +AI    A+E  G  AFA  + + ++NL   NF+  +  ++    + V
Sbjct: 71  SFAFSFLPVMFCIAIPLGLARENKGVAAFAGFIGYAVMNLAV-NFWLTNKGILPTTDAAV 129

Query: 121 HNIFGGKMHVADYFINVLGQPALNMGVFVGIISGFVGATAYNKYYNFRKLPDVLSFFNGK 180
                     A+   ++LG  +++ G+   +I+G +    + +++N R LPD L+FF G 
Sbjct: 130 LK--------ANNIQSILGIQSIDTGILGAVIAGIIVWMLHERFHNIR-LPDALAFFGGT 180

Query: 181 RFVPFVVIVRSTIVALILSVFWPIVQSGINGFGMWIASSQHTAPFLAPFLYGTLERLLLP 240
           RFVP +  +   +V L++ + WPI   GI+G G  I S    A    P L+GT ERLLLP
Sbjct: 181 RFVPIISSLVMGLVGLVIPLVWPIFAMGISGLGHMINS----AGDFGPMLFGTGERLLLP 236

Query: 241 FGLHHMLTIPMNYTQLGGTYVVLTGAQAGKHVLGQDPLWLAWVQDLIHLKGAGHMSQYHH 300
           FGLHH+L   + +T  GGT  V     +G   + Q  L                    H 
Sbjct: 237 FGLHHILVALIRFTDAGGTQEVCGQTVSGALTIFQAQL---------------SCPTTHG 281

Query: 301 LLTSVTPARF-KVGQMIGSSGILMGLTLAMYRNVDPDKKEKYKGMFLSAAVAVFLTGVTE 359
              S T  RF   G+M    G L G  LAMY    P+ + K KG+ +S  +A  + G TE
Sbjct: 282 FSESAT--RFLSQGKMPAFLGGLPGAALAMYHCARPENRHKIKGLLISGLIACVVGGTTE 339

Query: 360 PLEYMFMFAALPLYLVYAVVQGLAFASADLIHLRV-HSFGNIEFLTRTPMAIKAGLAMDI 418
           PLE++F+F A  LY+++A++ GL F    ++ + + ++ GNI  +      I  GL+   
Sbjct: 340 PLEFLFLFVAPVLYVIHALLTGLGFTVMSVLGVTIGNTDGNI--IDFVVFGILHGLSTKW 397

Query: 419 VNFIVVSVVFGVAMYFITNFMIKKFNLATSGRNGNYDTGDDASDETASNSNAGTANANSQ 478
               VV+ ++ V  Y I  F I +FNL T GR    D+   +S E A     G +  N  
Sbjct: 398 YMVPVVAAIWFVVYYVIFRFAITRFNLKTPGR----DSEVASSIEKAVAGAPGKSGYN-- 451

Query: 479 IVKIINLLGGKENISDVDACMTRLRITVTDVAKVGDEAAWKKAGAMGLI-VKGNGVQAVY 537
           +  I+  LGG +NI  +D C+TRLR++V D++ V  +A  K   A+G++ +  + +Q V 
Sbjct: 452 VPAILEALGGADNIVSLDNCITRLRLSVKDMSLVNVQAL-KDNRAIGVVQLNQHNLQVVI 510

Query: 538 GPKADVLKSDIQDLL 552
           GP+   +K ++  L+
Sbjct: 511 GPQVQSVKDEMAGLM 525


Lambda     K      H
   0.322    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 855
Number of extensions: 52
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 729
Length of database: 530
Length adjustment: 37
Effective length of query: 692
Effective length of database: 493
Effective search space:   341156
Effective search space used:   341156
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory