Align ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) (characterized)
to candidate 15432 b1312 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)
Query= BRENDA::P68183 (296 letters) >FitnessBrowser__Keio:15432 Length = 280 Score = 139 bits (349), Expect = 1e-37 Identities = 85/280 (30%), Positives = 147/280 (52%), Gaps = 19/280 (6%) Query: 20 LLLFIAAIMFPLLMVVAISLRQGNFATG---SLIPEQISWDHWKLALGFSVEQADGRITP 76 L LF+ +FP +++ S + A +L+P+Q + +H+ P Sbjct: 17 LALFLIITLFPFFVMLMTSFKGAKEAISLHPTLLPQQWTLEHYV-----------DIFNP 65 Query: 77 PPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLS 136 FP + + NS+ V+ +S++ V L AYA +R+RF G+ T+ MF +L Sbjct: 66 MIFPFVDYFRNSLVVSVVSSVVAVFLGILGAYALSRLRFKGRMTINASFYTVYMFSGILL 125 Query: 137 LVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDG 196 +V L+ + LG Y + L +I + V+ +K YF+TI +EEAA +DG Sbjct: 126 VVPLFKIITALGIYDTEMAL-----IITMVTQTLPTAVFMLKSYFDTIPDEIEEAAMMDG 180 Query: 197 ATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQ 256 Q + +PL++ L VF+ F+ A + AS+ L +++TL VG+ + Sbjct: 181 LNRLQIIFRITVPLAMSGLISVFVYCFMVAWNDYLFASIFLSSASNFTLPVGLNALFSTP 240 Query: 257 NYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG 296 +Y+WG AA++++ALP+ I++ L++R++ +GLTAGGVKG Sbjct: 241 DYIWGRMMAASLVTALPVVIMYALSERFIKSGLTAGGVKG 280 Lambda K H 0.328 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 280 Length adjustment: 26 Effective length of query: 270 Effective length of database: 254 Effective search space: 68580 Effective search space used: 68580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory