Align ABC-type Maltose/ Maltodextrin permease (characterized, see rationale)
to candidate 15432 b1312 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)
Query= uniprot:Q6MNM1 (272 letters) >FitnessBrowser__Keio:15432 Length = 280 Score = 164 bits (414), Expect = 3e-45 Identities = 86/276 (31%), Positives = 159/276 (57%), Gaps = 6/276 (2%) Query: 3 KKTFSWIS----ILLFSLFSIYPILYVLSVSLRPDNAFQTQSLEIIGPNASFKNFVDLFA 58 K+T S I + LF + +++P +L S + + ++ + +++VD+F Sbjct: 5 KRTLSRIGFYCGLALFLIITLFPFFVMLMTSFKGAKEAISLHPTLLPQQWTLEHYVDIFN 64 Query: 59 TT--DFLIWMRNSLVVSAATTLLGVALASTSAYALARYRFRGRNMMLFSLLMTQMFPATM 116 F+ + RNSLVVS ++++ V L AYAL+R RF+GR + S MF + Sbjct: 65 PMIFPFVDYFRNSLVVSVVSSVVAVFLGILGAYALSRLRFKGRMTINASFYTVYMFSGIL 124 Query: 117 LMLPFYIILSKLRLIDSFWGLFLIYSSTALPFCIWQMKAYYDTIPRELEEAALLDGCSKW 176 L++P + I++ L + D+ L + + LP ++ +K+Y+DTIP E+EEAA++DG ++ Sbjct: 125 LVVPLFKIITALGIYDTEMALIITMVTQTLPTAVFMLKSYFDTIPDEIEEAAMMDGLNRL 184 Query: 177 MIFYKIILPVSSPALVITALFSFMSSWSEYVIAAVVLQDPQLYTLPLGLRSFQASLATQW 236 I ++I +P++ L+ ++ FM +W++Y+ A++ L +TLP+GL + ++ W Sbjct: 185 QIIFRITVPLAMSGLISVFVYCFMVAWNDYLFASIFLSSASNFTLPVGLNALFSTPDYIW 244 Query: 237 GLYAAGALIVSVPVLILFISISRYLVSGLTMGSVKG 272 G A +L+ ++PV+I++ R++ SGLT G VKG Sbjct: 245 GRMMAASLVTALPVVIMYALSERFIKSGLTAGGVKG 280 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 280 Length adjustment: 25 Effective length of query: 247 Effective length of database: 255 Effective search space: 62985 Effective search space used: 62985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory