Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate 15248 b1126 putrescine/spermidine ABC transporter ATPase protein (NCBI)
Query= BRENDA::Q70HW1 (384 letters) >FitnessBrowser__Keio:15248 Length = 378 Score = 249 bits (637), Expect = 7e-71 Identities = 135/297 (45%), Positives = 194/297 (65%), Gaps = 12/297 (4%) Query: 4 VLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEGNLY 63 V L I K + G+ + +L I + EF +GPSGCGKTT LR+IAGLE + G + Sbjct: 18 VQLAGIRKCFDGKE--VIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIM 75 Query: 64 IGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAAKIL 123 + + + VP ++R + VFQ+YAL+PHMTV++N+AFGL+++K P AEI RV EA +++ Sbjct: 76 LDNEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMV 135 Query: 124 DIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLHQ 183 + RKP LSGGQ+QRVA+ RA+V +P++ L+DE LS LD KLR QM+ E++ L + Sbjct: 136 QLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQR 195 Query: 184 RLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPAMNF 243 +L T ++VTHDQ EA+TM DRIVVMRDG I+Q TP+ +Y +PKN+FVAGFIG +N Sbjct: 196 KLGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGE--INM 253 Query: 244 IRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAI--GKPVVLGVRPEDLHDEEV 298 +++ D RA EGR + + A+ G+ + + +RPEDL EE+ Sbjct: 254 FNATVIERLDEQRVRAN------VEGRECNIYVNFAVEPGQKLHVLLRPEDLRVEEI 304 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 378 Length adjustment: 30 Effective length of query: 354 Effective length of database: 348 Effective search space: 123192 Effective search space used: 123192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory