Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate 14400 b0262 putative ATP-binding component of a transport system (VIMSS)
Query= uniprot:Q6MNM2 (347 letters) >FitnessBrowser__Keio:14400 Length = 348 Score = 228 bits (581), Expect = 2e-64 Identities = 128/311 (41%), Positives = 189/311 (60%), Gaps = 15/311 (4%) Query: 4 IQFSNIKKSFGSADVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTISID 63 ++ N+ K FGS V+ I+L I G+ + L+GPSGCGK+T+LR +AGLE G I ID Sbjct: 7 VELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSEGQIFID 66 Query: 64 GKKINDIEPQNRDIAMVFQSYALYPHMTVAENMGFGLKLKNLAAAEITKRVNEISELLQI 123 G+ + Q RDI MVFQSYAL+PHM++ EN+G+GLK+ + AE+ RV E ++ + Sbjct: 67 GEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLKMLGVPRAELKARVKEALAMVDL 126 Query: 124 KHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKRLHHNS 183 + DR ++SGGQ+QRVAL RAL + V+LFDEPLSNLDA+LR MR +I+ L Sbjct: 127 EGFEDRFVDQISGGQQQRVALARALILKPKVLLFDEPLSNLDANLRRSMRDKIRELQKQF 186 Query: 184 KSTMIYVTHDQMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFIGSPEM---N 240 T +YVTHDQ EA + D + V+ G I QIG+P ++Y +P + F+A+F+G + Sbjct: 187 DITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQDLYRQPASRFMASFMGDANLFPAT 246 Query: 241 FLEGAV------LEKIPWPEARKADQILGIRPDAFALNQGPLGTQ-----EVALGDFQID 289 F +G V L + P + + ++G+RP+A L+ +Q VA Q + Sbjct: 247 FSDGYVDIYGYHLPR-PLHFGTQGEGMVGVRPEAITLSDRGEESQRCVIRHVAYMGPQYE 305 Query: 290 ISENLGGQQML 300 ++ GQ++L Sbjct: 306 VTVEWHGQEIL 316 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 348 Length adjustment: 29 Effective length of query: 318 Effective length of database: 319 Effective search space: 101442 Effective search space used: 101442 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory