GapMind for catabolism of small carbon sources

 

Aligments for a candidate for malK_Ss in Escherichia coli BW25113

Align MalK, component of Maltose and maltooligosaccharide porter (characterized)
to candidate 1936449 b1246 oligopeptide transporter ATP-binding component (NCBI)

Query= TCDB::Q97UG5
         (617 letters)



>lcl|FitnessBrowser__Keio:1936449 b1246 oligopeptide transporter
           ATP-binding component (NCBI)
          Length = 337

 Score =  221 bits (562), Expect = 5e-62
 Identities = 122/317 (38%), Positives = 187/317 (58%), Gaps = 6/317 (1%)

Query: 6   DSLLKVNELTAGYFNQDGFVIGVTNVNFEVYPNEIFAIAGESGCGKSTLAMAIYGLLKYP 65
           D+LL V +L   +   DG V  V ++NF +   E   I GESG GKS  A A+ GLL   
Sbjct: 17  DALLNVKDLRVTFSTPDGDVTAVNDLNFSLRAGETLGIVGESGSGKSQTAFALMGLLAAN 76

Query: 66  GVVLRGHVYLKDKDILSITQEELRKLRMKEFVYVPQFAMDALDPVAKIGDQMMRAAVSH- 124
           G +  G      ++IL++ + EL KLR ++   + Q  M +L+P  ++G+Q+M   + H 
Sbjct: 77  GRI-GGSATFNGREILNLPEHELNKLRAEQISMIFQDPMTSLNPYMRVGEQLMEVLMLHK 135

Query: 125 GVNVEEARKLIKEKLELVDLPY--NVVNMYPHELSGGMRQRVVIATSILLNPSLIILDEP 182
            ++  EA +     L+ V +P     + MYPHE SGGMRQRV+IA ++L  P L+I DEP
Sbjct: 136 NMSKAEAFEESVRMLDAVKMPEARKRMKMYPHEFSGGMRQRVMIAMALLCRPKLLIADEP 195

Query: 183 TTGLDVIVQYEILKDLKRIQRQLGVSLVIISHDISMLLMISDRVGIMYAGEIVEIGSKEE 242
           TT LDV VQ +I+  L  ++R+   ++++I+HD+ ++  I D+V +MYAG  +E G+  +
Sbjct: 196 TTALDVTVQAQIMTLLNELKREFNTAIIMITHDLVVVAGICDKVLVMYAGRTMEYGNARD 255

Query: 243 IIKRPSHPYTYLLISSLPSLVKRREKLLSIPGNPPLMLSKVPNSCRFYDRCPFKMEKCST 302
           +  +P HPY+  L++++P L    E +L+IPGNPP +L ++P  C F  RCP  ME CS+
Sbjct: 256 VFYQPVHPYSIGLLNAVPRLDAEGETMLTIPGNPPNLL-RLPKGCPFQPRCPHAMEICSS 314

Query: 303 LNPALGDIMDGHKARCF 319
             P L +   G    CF
Sbjct: 315 A-PPLEEFTPGRLRACF 330



 Score =  152 bits (383), Expect = 3e-41
 Identities = 88/239 (36%), Positives = 134/239 (56%), Gaps = 6/239 (2%)

Query: 378 INAVNDVSFELKKGTITALVGGSGHGKSTIAKILAGMIQ---QTSGKIILLGKDVSEYGV 434
           + AVND++F L+ G    +VG SG GKS  A  L G++    +  G     G+++     
Sbjct: 36  VTAVNDLNFSLRAGETLGIVGESGSGKSQTAFALMGLLAANGRIGGSATFNGREILNLPE 95

Query: 435 RN-SMWYKENVQMIFQDPYSSLDPRHTVRWHVERPLLIHKKVSNKDQLLPKIIEVLKNVG 493
              +    E + MIFQDP +SL+P   V   +   L++HK +S K +   + + +L  V 
Sbjct: 96  HELNKLRAEQISMIFQDPMTSLNPYMRVGEQLMEVLMLHKNMS-KAEAFEESVRMLDAVK 154

Query: 494 LKPPEKYLYKYPHELSGGERQRVAIARATAVEPKVLVADEPVSMLDASLRAGILNLIKKF 553
           +    K +  YPHE SGG RQRV IA A    PK+L+ADEP + LD +++A I+ L+ + 
Sbjct: 155 MPEARKRMKMYPHEFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMTLLNEL 214

Query: 554 KKN-GISILYITHDIATVNYIADEIMVIYKGRIVEKGNTYEVISNPSHEYTKRLIEAVP 611
           K+    +I+ ITHD+  V  I D+++V+Y GR +E GN  +V   P H Y+  L+ AVP
Sbjct: 215 KREFNTAIIMITHDLVVVAGICDKVLVMYAGRTMEYGNARDVFYQPVHPYSIGLLNAVP 273


Lambda     K      H
   0.319    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 500
Number of extensions: 21
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 617
Length of database: 337
Length adjustment: 33
Effective length of query: 584
Effective length of database: 304
Effective search space:   177536
Effective search space used:   177536
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory