Align Trehalose/maltose transport system permease protein MalG (characterized)
to candidate 15432 b1312 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)
Query= SwissProt::Q7LYX6 (278 letters) >FitnessBrowser__Keio:15432 Length = 280 Score = 180 bits (457), Expect = 3e-50 Identities = 106/278 (38%), Positives = 166/278 (59%), Gaps = 5/278 (1%) Query: 3 EEVLKRILLIIGAILMAIICLFPFIWMIVVSF--AEDPTFLGSPLVEYKSTLENYVRVLS 60 + L RI G L II LFPF M++ SF A++ L L+ + TLE+YV + + Sbjct: 5 KRTLSRIGFYCGLALFLIITLFPFFVMLMTSFKGAKEAISLHPTLLPQQWTLEHYVDIFN 64 Query: 61 DPTLHFPAYLKNSIIIASLVTLTTVSISSLAAYAVSRIEFKGRLLIPIFVLGLSMFPQIS 120 F Y +NS++++ + ++ V + L AYA+SR+ FKGR+ I + MF I Sbjct: 65 PMIFPFVDYFRNSLVVSVVSSVVAVFLGILGAYALSRLRFKGRMTINASFYTVYMFSGIL 124 Query: 121 LVGYLFKFIEKLGWVNTYQALYFPYVAWTLPLSLWILLSYFSQLPKDLDEAAMIDGASRI 180 LV LFK I LG +T AL V TLP ++++L SYF +P +++EAAM+DG +R+ Sbjct: 125 LVVPLFKIITALGIYDTEMALIITMVTQTLPTAVFMLKSYFDTIPDEIEEAAMMDGLNRL 184 Query: 181 KTLTTIILPLSAPALFSTALLVFIAAFNEFMFALLFTTDHRARTVPVGI-ALFQGVHGEI 239 + + I +PL+ L S + F+ A+N+++FA +F + T+PVG+ ALF + Sbjct: 185 QIIFRITVPLAMSGLISVFVYCFMVAWNDYLFASIFLSSASNFTLPVGLNALFS--TPDY 242 Query: 240 PWGSVMAASVISTIPLVIMALLFQKYIVSGLTAGALKG 277 WG +MAAS+++ +P+VIM L +++I SGLTAG +KG Sbjct: 243 IWGRMMAASLVTALPVVIMYALSERFIKSGLTAGGVKG 280 Lambda K H 0.329 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 280 Length adjustment: 26 Effective length of query: 252 Effective length of database: 254 Effective search space: 64008 Effective search space used: 64008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory