Align mannitol dehydrogenase (EC 1.1.1.255) (characterized)
to candidate 18294 b4269 putative oxidoreductase (VIMSS)
Query= BRENDA::Q38707 (365 letters) >FitnessBrowser__Keio:18294 Length = 339 Score = 222 bits (565), Expect = 1e-62 Identities = 114/338 (33%), Positives = 191/338 (56%), Gaps = 11/338 (3%) Query: 16 WAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPGHEIV 75 +AA++ G L +++ +DV ++V +CG+CHSD MI N WGF+ YP+V GHE++ Sbjct: 7 YAAKEAGGELEVYEYDPGELRPQDVEVQVDYCGICHSDLSMIDNEWGFSQYPLVAGHEVI 66 Query: 76 GVVTEVGSKVEK--VKVGDNVGIGCLVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTM 133 G V +GS + ++VG VGIG SC C++C + +CE G++ M Sbjct: 67 GRVVALGSAAQDKGLQVGQRVGIGWTARSCGHCDACISGNQINCEQ-----GAV--PTIM 119 Query: 134 THGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGLDKPGTKIGVVGLG 193 GG+++ + AD +++ P+N+ ++S PLLC GIT + PL + + +++GV+G+G Sbjct: 120 NRGGFAEKLRADWQWVIPLPENIDIESAGPLLCGGITVFKPLLMHHITAT-SRVGVIGIG 178 Query: 194 GLGHVAVKMAKAFGAQVTVIDISESKRKEALEKLGADSFLLNSDQEQMKGARSSLDGIID 253 GLGH+A+K+ A G +VT + +K +E L +GAD + + D + +K D II+ Sbjct: 179 GLGHIAIKLLHAMGCEVTAFSSNPAKEQEVLA-MGADKVVNSRDPQALKALAGQFDLIIN 237 Query: 254 TVPVNHPLAPLFDLLKPNGKLVMVGAPEKPFELPVFSLLKGRKLLGGTINGGIKETQEML 313 TV V+ P F+ L G VGA P +P F+L+ G + + G+ G E ++++ Sbjct: 238 TVNVSLDWQPYFEALTYGGNFHTVGAVLTPLSVPAFTLIAGDRSVSGSATGTPYELRKLM 297 Query: 314 DFAAKHNITADVEVIPMDYVNTAMERLVKSDVRYRFVI 351 FAA+ + E+ PM +N A++ + RYR V+ Sbjct: 298 RFAARSKVAPTTELFPMSKINDAIQHVRDGKARYRVVL 335 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 339 Length adjustment: 29 Effective length of query: 336 Effective length of database: 310 Effective search space: 104160 Effective search space used: 104160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory