Align SmoG, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate 15432 b1312 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)
Query= TCDB::O30833 (276 letters) >FitnessBrowser__Keio:15432 Length = 280 Score = 121 bits (304), Expect = 1e-32 Identities = 82/278 (29%), Positives = 143/278 (51%), Gaps = 5/278 (1%) Query: 2 SRRTSTRRTLIVTLAAWTIAFLIFFPILWTVLMSFKSEGDAIKAPFAMLFSDWTLQSYAD 61 ++RT +R LA + I L FP ++ SFK +AI +L WTL+ Y D Sbjct: 4 NKRTLSRIGFYCGLALFLIITL--FPFFVMLMTSFKGAKEAISLHPTLLPQQWTLEHYVD 61 Query: 62 VQERS--NYARHFMNSVVISLGSTLVALAIAIPAAWAMAFVPGRRTKDVLMWMLSTKMMP 119 + + +F NS+V+S+ S++VA+ + I A+A++ + + + + M Sbjct: 62 IFNPMIFPFVDYFRNSLVVSVVSSVVAVFLGILGAYALSRLRFKGRMTINASFYTVYMFS 121 Query: 120 AVGVLIPLYLIFRDTGLLDTRIGLVIVLTLINLPIVVWMLYTYFKEIPGEILEAARMDGA 179 + +++PL+ I G+ DT + L+I + LP V+ML +YF IP EI EAA MDG Sbjct: 122 GILLVVPLFKIITALGIYDTEMALIITMVTQTLPTAVFMLKSYFDTIPDEIEEAAMMDGL 181 Query: 180 TLGSEILYILTPMAVPGIASTLLLNVILAWNE-AFWTLQLTTSRAAPLTQFIASYSSPEG 238 I I P+A+ G+ S + ++AWN+ F ++ L+++ L + + S Sbjct: 182 NRLQIIFRITVPLAMSGLISVFVYCFMVAWNDYLFASIFLSSASNFTLPVGLNALFSTPD 241 Query: 239 LFYAKLSAASTMAIAPILILGWFSQKQLVRGLTFGAVK 276 + ++ AAS + P++I+ S++ + GLT G VK Sbjct: 242 YIWGRMMAASLVTALPVVIMYALSERFIKSGLTAGGVK 279 Lambda K H 0.327 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 280 Length adjustment: 25 Effective length of query: 251 Effective length of database: 255 Effective search space: 64005 Effective search space used: 64005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory