Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate 14954 b0829 fused predicted peptide transport subunits of ABC superfamily: ATP-binding components (RefSeq)
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__Keio:14954 Length = 623 Score = 248 bits (632), Expect = 4e-70 Identities = 128/266 (48%), Positives = 180/266 (67%), Gaps = 6/266 (2%) Query: 4 LLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNGR 63 +L V NL + F + + + AV +S+ L +GE+L IVGESGSGKSV+ L+L+RL+ + G Sbjct: 12 VLAVENLNIAFMQDQQKIAAVRNLSFSLQRGETLAIVGESGSGKSVTALALMRLLEQAGG 71 Query: 64 IVDGEAIFLGK------DLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPI 117 +V + + L + +L + N ++R++RG D+++IFQ PMTSLNP+ VG Q+ E I Sbjct: 72 LVQCDKMLLQRRSREVIELSEQNAAQMRHVRGADMAMIFQEPMTSLNPVFTVGEQIAESI 131 Query: 118 IWHRLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLI 177 H+ EEA A +L++V IPE+ YP Q SGGMRQRVMIAMAL+C P +LI Sbjct: 132 RLHQNASREEAMVEAKRMLDQVRIPEAQTILSRYPHQLSGGMRQRVMIAMALSCRPAVLI 191 Query: 178 ADEPTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEA 237 ADEPTTALDVTIQAQI++L++ L++E M VIFITHD+ V DR++ MY G+ VE Sbjct: 192 ADEPTTALDVTIQAQILQLIKVLQKEMSMGVIFITHDMGVVAEIADRVLVMYQGEAVETG 251 Query: 238 PVEEILKTPLHPYTKGLLNSTLEIGS 263 VE+I P HPYT+ LL + ++G+ Sbjct: 252 TVEQIFHAPQHPYTRALLAAVPQLGA 277 Score = 194 bits (493), Expect = 5e-54 Identities = 111/259 (42%), Positives = 163/259 (62%), Gaps = 14/259 (5%) Query: 4 LLNVNNLKVEF-------HRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLR 56 +L V NL F +RV V AV+ +S+ L GE+L +VGESGSGKS + +LLR Sbjct: 313 VLRVRNLVTRFPLRSGLLNRVTREVHAVEKVSFDLWPGETLSLVGESGSGKSTTGRALLR 372 Query: 57 LINRNGRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEP 116 L+ G GE IF G+ + L+ +L+ +R +DI IFQ+P SL+P +G ++EP Sbjct: 373 LVESQG----GEIIFNGQRIDTLSPGKLQALR-RDIQFIFQDPYASLDPRQTIGDSIIEP 427 Query: 117 IIWHRLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLL 176 + H L+ ++A R LLERVG+ P+ YP +FSGG RQR+ IA ALA +PK++ Sbjct: 428 LRVHGLLPGKDAAARVAWLLERVGL--LPEHAWRYPHEFSGGQRQRICIARALALNPKVI 485 Query: 177 IADEPTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEE 236 IADE +ALDV+I+ QI+ LL +L+ ++G++ +FI+HD++V R+ MY G+IVE Sbjct: 486 IADEAVSALDVSIRGQIINLLLDLQRDFGIAYLFISHDMAVVERISHRVAVMYLGQIVEI 545 Query: 237 APVEEILKTPLHPYTKGLL 255 P + + P HPYT+ LL Sbjct: 546 GPRRAVFENPQHPYTRKLL 564 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 324 Length of database: 623 Length adjustment: 33 Effective length of query: 291 Effective length of database: 590 Effective search space: 171690 Effective search space used: 171690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory