Align Fructose import permease protein FrcC (characterized)
to candidate 16257 b2148 beta-methylgalactoside transporter inner membrane component (NCBI)
Query= SwissProt::Q9F9B1 (360 letters) >FitnessBrowser__Keio:16257 Length = 336 Score = 175 bits (443), Expect = 2e-48 Identities = 106/313 (33%), Positives = 169/313 (53%), Gaps = 14/313 (4%) Query: 52 LIVLVLSLIAFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAIMV 111 + V++L L+A + F S ++ IL Q ++ I+ +I+T G DLS G + Sbjct: 18 IYVVLLVLLAIIIFQDPTFLSLLNLSNILTQSSVRIIIALGVAGLIVTQGTDLSAGRQVG 77 Query: 112 LSSVIMGQ-----------FTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIV 160 L++V+ F P AL ++ +GA+ G ING ++A + + PFI Sbjct: 78 LAAVVAATLLQSMDNANKVFPEMATMPIALVILIVCAIGAVIGLINGLIIAYLNVTPFIT 137 Query: 161 TLGMWQIVLASNFLYSANETIRAQDISANASILQFFGQNF-RIGNAVFTYGVVVMVLLVC 219 TLG IV N LY + + A IS S F Q F +G+ +Y ++ V Sbjct: 138 TLGTMIIVYGINSLYY--DFVGASPISGFDSGFSTFAQGFVALGSFRLSYITFYALIAVA 195 Query: 220 LLWYVLNRTAWGRYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGS 279 +W + N+T +G+ ++A+G +PEAAK++GVNV L+ IY LSG+ A G GRIGS Sbjct: 196 FVWVLWNKTRFGKNIFAIGGNPEAAKVSGVNVGLNLLMIYALSGVFYAFGGMLEAGRIGS 255 Query: 280 VSPTAGQFANIESITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYL 339 + G +++I A V+GG+S GG G+++G++ G +I V + GL +G +P W Y+ Sbjct: 256 ATNNLGFMYELDAIAACVVGGVSFSGGVGTVIGVVTGVIIFTVINYGLTYIGVNPYWQYI 315 Query: 340 LIGLLIIIAVAID 352 + G +II AVA+D Sbjct: 316 IKGAIIIFAVALD 328 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 336 Length adjustment: 29 Effective length of query: 331 Effective length of database: 307 Effective search space: 101617 Effective search space used: 101617 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory