Align protein-Npi-phosphohistidine-D-mannose phosphotransferase (EC 2.7.1.191) (characterized)
to candidate 17939 b3899 PTS system, fructose-like enzyme IIBC component (VIMSS)
Query= BRENDA::O31645 (650 letters) >FitnessBrowser__Keio:17939 Length = 483 Score = 286 bits (731), Expect = 2e-81 Identities = 166/471 (35%), Positives = 264/471 (56%), Gaps = 24/471 (5%) Query: 1 MKLLAITSCPNGIAHTYMAAENLQKAADRLGVSIKVETQGGIGVENKLTEEEIREADAII 60 ++++AIT+CP GIAHTYM AE L++ A LG +IKVETQG GVEN+L+ EEI AD +I Sbjct: 5 LRIVAITNCPAGIAHTYMVAEALEQKARSLGHTIKVETQGSSGVENRLSSEEIAAADYVI 64 Query: 61 IAADRSVNKD---RFIGKKLLSVGVQDGIRKPEELIQKALNGDIPVYRSATKSESG---N 114 +A R ++ D RF GKK+ + + ++ +++ ++P ++SG Sbjct: 65 LATGRGLSGDDRARFAGKKVYEIAISQALKNIDQIFS-----ELPTNSQLFAADSGVKLG 119 Query: 115 HQEKKQNPIYRHLMNGVSFMVPFIVVGGLLIAVALTLGGEKTPKGLVIPD-----DSFWK 169 QE + + HLM GVS +PF++ GG+L+A+A L GL D SF Sbjct: 120 KQEVQSGSVMSHLMAGVSAALPFVIGGGILVALANML----VQFGLPYTDMSKGAPSFTW 175 Query: 170 TIEQIGSASFSFMIPILAGYIAYSIADKPGLVPGMIGGYIAATGSFYDSASGAGFLGGII 229 +E IG F+FMIPI+ YIA SIADKP P + Y+A + + SGAGFLG ++ Sbjct: 176 VVESIGYLGFTFMIPIMGAYIASSIADKPAFAPAFLVCYLANDKALLGTQSGAGFLGAVV 235 Query: 230 AGFLAGYAALWIKKLKVPKAIQPIMPIIIIPVFASLIVGLAFVFLIGAPVAQIFASLTVW 289 G GY W +K+++ KA+QP++ ++IP L+ G+ ++IG ++ + L + Sbjct: 236 LGLAIGYFVFWFRKVRLGKALQPLLGSMLIPFVTLLVFGVLTYYVIGPVMSDLMGGLLHF 295 Query: 290 LAGMKGSSSILLALILGAMISFDMGGPVNKVAFLFGSAMIGEGNYEIMGPIAVAICIPPI 349 L + S A ++GAM++FDMGGP+NK A+ F +++ + Y+ + V +PP+ Sbjct: 296 LNTIPPSMKFAAAFLVGAMLAFDMGGPINKTAWFFCFSLLEKHIYDWYAIVGVVALMPPV 355 Query: 350 GLGIATFLGKRKFEASQREMGKAAFTMGLFGITEGAIPFAAQDPLRVI-PSIMAGSMTGS 408 G+ATF+ + F ++E +A +G TE AIP+A PL +I + +AG +TG Sbjct: 356 AAGLATFIAPKLFTRQEKEAASSAIVVGATVATEPAIPYALAAPLPMITANTLAGGITGV 415 Query: 409 VIAMIGNVGDRVAHG-GPIVAVLGAVDHVLMFFIAVIAGSLVTALFVNVLK 458 ++ G R+A G G ++G + V F++ + G + F+ VLK Sbjct: 416 LVIAFGI--KRLAPGLGIFDPLIGLMSPVGSFYLVLAIGLALNISFIIVLK 464 Lambda K H 0.319 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 719 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 650 Length of database: 483 Length adjustment: 36 Effective length of query: 614 Effective length of database: 447 Effective search space: 274458 Effective search space used: 274458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory