Align Probable inositol transporter 2 (characterized)
to candidate 17022 b2943 D-galactose transporter (NCBI)
Query= SwissProt::Q9C757 (580 letters) >FitnessBrowser__Keio:17022 Length = 464 Score = 235 bits (599), Expect = 3e-66 Identities = 136/348 (39%), Positives = 208/348 (59%), Gaps = 26/348 (7%) Query: 31 LAFSAGIGGLLFGYDTGVISGALLYIRDDFKSVDRNTWLQEMIVSMAVAGAIVGAAIGGW 90 + F A + GLLFG D GVI+GAL +I D+F+ QE +VS + GA VGA GW Sbjct: 18 VCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHT---QEWVVSSMMFGAAVGAVGSGW 74 Query: 91 ANDKLGRRSAILMADFLFLLGAIIMAAAPNPSLLVVGRVFVGLGVGMASMTAPLYISEAS 150 + KLGR+ ++++ LF+ G++ AAAPN +L++ RV +GL VG+AS TAPLY+SE + Sbjct: 75 LSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIA 134 Query: 151 PAKIRGALVSTNGFLITGGQFLSYLINLAFTDVTGTWRWMLGIAGIPALLQFVLMFTLPE 210 P KIRG+++S +IT G +YL + AF+ TG WRWMLG+ IPA+L + +F LP+ Sbjct: 135 PEKIRGSMISMYQLMITIGILGAYLSDTAFS-YTGAWRWMLGVIIIPAILLLIGVFFLPD 193 Query: 211 SPRWLYRKGREEEAKAILRRIY-SAEDVEQEIRALKDSVETE-----ILEEGSSEKINMI 264 SPRW K R +A+ +L R+ ++ + ++E+ +++S++ + + +E S+ Sbjct: 194 SPRWFAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVKQSGWALFKENSN------ 247 Query: 265 KLCKAKTVRRGLIAGVGLQVFQQFVGINTVMYYSPTIVQLAGFASNRTALLLSLVTAGL- 323 RR + GV LQV QQF G+N +MYY+P I +LAG+ +N T + V GL Sbjct: 248 -------FRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFELAGY-TNTTEQMWGTVIVGLT 299 Query: 324 NAFGSIISIYFIDRIGRKKLLIISLFGVIISLGILTGVFYEAATHAPA 371 N + I+I +DR GRK L + + +G+L G H+P+ Sbjct: 300 NVLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVL-GTMMHIGIHSPS 346 Score = 73.9 bits (180), Expect = 1e-17 Identities = 35/103 (33%), Positives = 63/103 (61%) Query: 454 WFALLGLGLYIIFFSPGMGTVPWIVNSEIYPLRFRGICGGIAATANWISNLIVAQSFLSL 513 +FA+ L ++I+ F+ G + W++ SEI PL+ R + NWI+N+IV +FL++ Sbjct: 349 YFAIAMLLMFIVGFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTM 408 Query: 514 TEAIGTSWTFLIFGVISVIALLFVMVCVPETKGMPMEEIEKML 556 +G + TF ++ ++V+ +L + VPETK + +E IE+ L Sbjct: 409 LNTLGNANTFWVYAALNVLFILLTLWLVPETKHVSLEHIERNL 451 Lambda K H 0.324 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 685 Number of extensions: 35 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 580 Length of database: 464 Length adjustment: 35 Effective length of query: 545 Effective length of database: 429 Effective search space: 233805 Effective search space used: 233805 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory