Align Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate 16645 b2546 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)
Query= TCDB::B8H230 (332 letters) >FitnessBrowser__Keio:16645 Length = 332 Score = 201 bits (511), Expect = 2e-56 Identities = 124/325 (38%), Positives = 187/325 (57%), Gaps = 12/325 (3%) Query: 1 MTAPSSPAPLATDKPRFDLLAFARKHRTILFLLLLVA----VFGAANERFLTARNALNIL 56 M+A S P P L F +H + LL+++A VF F++ N +N+L Sbjct: 1 MSASSLPLPQGKS---VSLKQFVSRHINEIGLLVVIAILYLVFSLNAPGFISLNNQMNVL 57 Query: 57 SEVSIYGIIAVGMTFVILIGGIDVAVGSLLAFASIAAAYVVTAVVGDGPATWLIALLVST 116 + + GI A MT +I+ G IDV+VG ++AF S+ A+++ V A L+ LL+ Sbjct: 58 RDAATIGIAAWAMTLIIISGEIDVSVGPMVAFVSVCLAFLLQFEVPLAVAC-LLVLLLGA 116 Query: 117 LIGLAGGYVQGKAVTWLHVPAFIVTLGGMTVWRGATLLLNDGGPISGFNDAYRWWGSGEI 176 L+G G ++G +VP+F+ TLG + RG L + + P+ + W G+ Sbjct: 117 LMGTLAGVLRGV----FNVPSFVATLGLWSALRGMGLFMTNALPVPIDENEVLDWLGGQF 172 Query: 177 LFLPVPVVIFALVAAAGHVALRYTRYGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGA 236 L +PV +I ++ A R T +GR V+AVGGNA AA+L G+NV + ++ + G Sbjct: 173 LGVPVSALIMIVLFALFVFISRKTAFGRSVFAVGGNATAAQLCGINVRRVRILIFTLSGL 232 Query: 237 LAGLSGFLLSARLGSAEAVAGTGYELRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLS 296 LA ++G LL+ARLGS A A G E VIA+VV+GG +L+GG G + GT+LG L+I ++ Sbjct: 233 LAAVTGILLAARLGSGNAGAANGLEFDVIAAVVVGGTALSGGRGSLFGTLLGVLVITLIG 292 Query: 297 NGLVMLHVTSYVQQVVIGLIIVAAV 321 NGLV+L + S+ QQVV G+IIV AV Sbjct: 293 NGLVLLGINSFFQQVVRGVIIVVAV 317 Lambda K H 0.325 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 332 Length adjustment: 28 Effective length of query: 304 Effective length of database: 304 Effective search space: 92416 Effective search space used: 92416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory