Align scyllo-inosose 3-dehydrogenase; 2-keto-myo-inositol dehydrogenase; EC 1.1.1.- (characterized)
to candidate 16644 b2545 putative oxidoreductase (VIMSS)
Query= SwissProt::Q9WYP3 (395 letters) >FitnessBrowser__Keio:16644 Length = 353 Score = 95.1 bits (235), Expect = 3e-24 Identities = 76/255 (29%), Positives = 116/255 (45%), Gaps = 22/255 (8%) Query: 39 EVRVEEVPEPRIEKPTEIIIKVKACGICGSDVHMAQTDEEGYILYPGLTGFPVTL-GHEF 97 ++R VP P I +++IK+K+ GICGSDVH P + + GHE Sbjct: 16 DLREVAVPTPGIN---QVLIKMKSSGICGSDVHYIYHQHRATAAAPDKPLYQGFINGHEP 72 Query: 98 SGVVVEAGPEAINRRTNKRFEIGEPVCAEEMLWCGHCRPCAEGFPNHC--ENLNELGFNV 155 G +V G + F+ G+ V + CG C C GFP C E G+ Sbjct: 73 CGQIVAMGQGC------RHFKEGDRVLVYHISGCGFCPNCRRGFPISCTGEGKAAYGWQR 126 Query: 156 DGAFAEYVKVDAKYAWSLRELEGVYEGDRLFLAGSLVEPTSVAYNAVIVRGGGIRPGDNV 215 DG AEY+ + K L + YE G AY ++ G + DNV Sbjct: 127 DGGHAEYLLAEEKDLILLPDALS-YEDGAFISCG-----VGTAYEGIL--RGEVSGSDNV 178 Query: 216 VILGGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGA-DHVIDPTKENFVEAVLD 274 +++G GP+G+ A+ + K GA ++I + R +AK+LG DH T E + + + Sbjct: 179 LVVGLGPVGMMAMMLAKGRGAKRIIGVDMLPERLAMAKQLGVMDHGYLATTEGLPQIIAE 238 Query: 275 YTNGLGAKLFLEATG 289 T+G GA + L+ +G Sbjct: 239 LTHG-GADVALDCSG 252 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 353 Length adjustment: 30 Effective length of query: 365 Effective length of database: 323 Effective search space: 117895 Effective search space used: 117895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory