Align HutW aka HISW, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate 14505 b0367 taurine transporter subunit (NCBI)
Query= TCDB::Q9KKE2 (285 letters) >FitnessBrowser__Keio:14505 Length = 275 Score = 84.7 bits (208), Expect = 2e-21 Identities = 61/197 (30%), Positives = 101/197 (51%), Gaps = 8/197 (4%) Query: 79 LLETVGVLGIWDLTM-----QTLALMLMATIVSVVIGVPMGILVAKSRVVRNITLPVLDV 133 LL G G D T+ +L +++A +V+ G+P+GI + S VR I P++++ Sbjct: 62 LLTIAGPQGFMDATLWQHLAASLTRIMLALFAAVLFGIPVGIAMGLSPTVRGILDPIIEL 121 Query: 134 MQTMPSFVYLIPALMLFGLGKVPAILATIIYAVPPLIRLTDLGIRQVDAEVVEAATAFGG 193 + +P YL ++ FG+G+ IL + P+ G++ V + AA + G Sbjct: 122 YRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALAGVKSVQQVRIRAAQSLGA 181 Query: 194 SPGQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGA-RGLGEQVLNGIQTLDVGK 252 S Q+L+ V LP A P I+ GL + + S +V A +I A RGLG V + + L Sbjct: 182 SRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAATRGLGFMVQSAGEFLATDV 241 Query: 253 GLEAGIGIV-ILAVVLD 268 L AGI ++ I+A +L+ Sbjct: 242 VL-AGIAVIAIIAFLLE 257 Lambda K H 0.327 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 275 Length adjustment: 26 Effective length of query: 259 Effective length of database: 249 Effective search space: 64491 Effective search space used: 64491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory