Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate 16236 b2128 predicted transporter subunit: membrane component of ABC superfamily (NCBI)
Query= SwissProt::P14176 (354 letters) >FitnessBrowser__Keio:16236 Length = 243 Score = 93.2 bits (230), Expect = 6e-24 Identities = 56/183 (30%), Positives = 96/183 (52%), Gaps = 6/183 (3%) Query: 145 AMVTLALVLTALLFCIVIGLPLGIWLARSPRAAKIIRPLLDAM----QTTPAFVYLVPIV 200 A+ LV + LF ++IG GI + R P A+ RPL++ + QT P L V Sbjct: 50 ALAHFWLVGISSLFAVIIGTGAGIAVTR-PWGAEF-RPLVETIAAVGQTFPPVAVLAIAV 107 Query: 201 MLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLA 260 + G G P ++ I++ + P+++ T+ G+ + A + E ++ G S Q + KV+LPLA Sbjct: 108 PVIGFGLQPAIIALILYGVLPVLQATLAGLGAIDASVTEVAKGMGMSRGQRVRKVELPLA 167 Query: 261 MPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIIL 320 P I+AGV ++++ + IAS + LG ++ G+ + G + + + AII Sbjct: 168 APVILAGVRTSVIINIGTATIASTVGASTLGTPIIIGLSGFNTAYVIQGALLVALAAIIA 227 Query: 321 DRL 323 DRL Sbjct: 228 DRL 230 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 243 Length adjustment: 26 Effective length of query: 328 Effective length of database: 217 Effective search space: 71176 Effective search space used: 71176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory