GapMind for catabolism of small carbon sources

 

Aligments for a candidate for putA in Escherichia coli BW25113

Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate 14450 b0312 betaine aldehyde dehydrogenase, NAD-dependent (NCBI)

Query= BRENDA::Q72IB9
         (516 letters)



>lcl|FitnessBrowser__Keio:14450 b0312 betaine aldehyde
           dehydrogenase, NAD-dependent (NCBI)
          Length = 490

 Score =  239 bits (609), Expect = 2e-67
 Identities = 158/485 (32%), Positives = 238/485 (49%), Gaps = 26/485 (5%)

Query: 40  LYIGGEWVDTKERMV--SLNPSAPSEVVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQED 97
           LYI G +          ++NP A   V+ T   AG+ + + A+++A +  K W      +
Sbjct: 9   LYIHGGYTSATSGRTFETINP-ANGNVLATVQAAGREDVDRAVKSAQQGQKIWASMTAME 67

Query: 98  RSRLLLKAAALMRRRKRELEATLVYEVGKNWVEASA-DVAEAIDFIEYYARAALRYRYPA 156
           RSR+L +A  ++R R  EL      + GK + E S  D+    D +EYYA        PA
Sbjct: 68  RSRILRRAVDILRERNDELAKLETLDTGKAYSETSTVDIVTGADVLEYYAGLI-----PA 122

Query: 157 VEVVPYPGEDNESFYV---PLGAGVVIAPWNFPVAIFTGMIMGPVAVGNTVIAKPAEDAV 213
           +E    P  +    Y    PLG    I  WN+P+ I        +A GN +I KP+E   
Sbjct: 123 LEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTP 182

Query: 214 VVGAKVFEIFHEAGFPPGVVNFLPGVGEEVGAYLVEHPRTRFINFTGSLEVGLKIYEAAG 273
           +   K+ EI+ EAG P GV N LPGVG E G YL EHP    ++FTG +  G K+   + 
Sbjct: 183 LTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEHPGIAKVSFTGGVASGKKVMANSA 242

Query: 274 RLAPGQTWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKCSAASRLILTQG 333
             +      K   +E GGK  +IV + AD DLAA+  +++ +   GQ C+  +R+ +   
Sbjct: 243 ASS-----LKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFSSGQVCTNGTRVFVPAK 297

Query: 334 AYEPVLERVLKRAERLSVGPA-EENPDLGPVVSAEQERKVLSYIEIGKNEGQLVL-GGKR 391
                 +++L R ER+  G   +   + GP+VS      VL YI  GK EG  VL GG  
Sbjct: 298 CKAAFEQKILARVERIRAGDVFDPQTNFGPLVSFPHRDNVLRYIAKGKEEGARVLCGGDV 357

Query: 392 LEGEGY----FIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTG 447
           L+G+G+    ++APTVFT+      I +EEIFGPV+S++  +   E +  ANDT YGL  
Sbjct: 358 LKGDGFDNGAWVAPTVFTDCSDDMTIVREEIFGPVMSILTYESEDEVIRRANDTDYGLAA 417

Query: 448 GVYSRKREHLEWARREFHVGNLYFNRKITGALVGVQPFGGFKLSGTNAKTGALDYLRLFL 507
           G+ +           +   G  + N    G      P GG+K SG   + G +  L+ + 
Sbjct: 418 GIVTADLNRAHRVIHQLEAGICWIN--TWGESPAEMPVGGYKHSGIGRENGVMT-LQSYT 474

Query: 508 EMKAV 512
           ++K++
Sbjct: 475 QVKSI 479


Lambda     K      H
   0.319    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 576
Number of extensions: 35
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 516
Length of database: 490
Length adjustment: 34
Effective length of query: 482
Effective length of database: 456
Effective search space:   219792
Effective search space used:   219792
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory