Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate 17649 b3588 aldehyde dehydrogenase B (lactaldehyde dehydrogenase) (VIMSS)
Query= BRENDA::P23883 (495 letters) >FitnessBrowser__Keio:17649 Length = 512 Score = 325 bits (833), Expect = 2e-93 Identities = 193/481 (40%), Positives = 280/481 (58%), Gaps = 16/481 (3%) Query: 23 FINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFERGDWSLSSPAK 82 FI GE+ A A+ E ++ + PVT L ++A DID A+ AA V ++ W+ +S Sbjct: 28 FIGGEWVAPADGEYYQNLTPVTGQLLCEVASSGKRDIDLALDAAHKVKDK--WAHTSVQD 85 Query: 83 RKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGEV 142 R A+L K+AD ME + E LA ET D GKPIR + D+P A R++A I G + Sbjct: 86 RAAILFKIADRMEQNLELLATAETWDNGKPIRETSAADVPLAIDHFRYFASCIRAQEGGI 145 Query: 143 ATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAIR 202 + S +A EP+GV+ I+PWNFPLL+ WK+ PALAAGN V+LKP+ +PLS + Sbjct: 146 SEVDSETVAYHFHEPLGVVGQIIPWNFPLLMASWKMAPALAAGNCVVLKPARLTPLSVLL 205 Query: 203 LAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGSTRTGKQLLKDAGDSNMK 262 L + + LP GV+NVV G G G+ L+ I +AFTGST G+Q+++ A N+ Sbjct: 206 LMEIVGDL-LPPGVVNVVNGAGGVIGEYLATSKRIAKVAFTGSTEVGQQIMQYA-TQNII 263 Query: 263 RVWLEAGGKSANIVFADCPDLQQAASATAAGIF----YNQGQVCIAGTRLLLEESIADEF 318 V LE GGKS NI FAD D + A A F +NQG+VC +R L++ESI + F Sbjct: 264 PVTLELGGKSPNIFFADVMDEEDAFFDKALEGFALFAFNQGEVCTCPSRALVQESIYERF 323 Query: 319 LALLKQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKGQLLLDGRNAGLAAA 378 + ++ ++ + G+PLD T MG + +++ ++I G+ +G +L G L Sbjct: 324 MERAIRRVESIRSGNPLDSVTQMGAQVSHGQLETILNYIDIGKKEGADVLTGGRRKLLEG 383 Query: 379 -------IGPTIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLANDSQYGLGAAVWT 431 + PTI + N + +EEIFGPVL VT F + E+AL+LAND+QYGLGA VW+ Sbjct: 384 ELKDGYYLEPTILFGQN-NMRVFQEEIFGPVLAVTTFKTMEEALELANDTQYGLGAGVWS 442 Query: 432 RDLSRAHRMSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTELKTIWI 491 R+ + A++M R ++AG V+ N Y+ FGGYKQSG GR+ LE + + K + + Sbjct: 443 RNGNLAYKMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLEHYQQTKCLLV 502 Query: 492 S 492 S Sbjct: 503 S 503 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 512 Length adjustment: 34 Effective length of query: 461 Effective length of database: 478 Effective search space: 220358 Effective search space used: 220358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory