GapMind for catabolism of small carbon sources

 

Alignments for a candidate for actP in Escherichia coli BW25113

Align Cation acetate symporter (characterized, see rationale)
to candidate 18095 b4067 acetate permease (NCBI)

Query= uniprot:A0A166PH03
         (552 letters)



>FitnessBrowser__Keio:18095
          Length = 549

 Score =  858 bits (2218), Expect = 0.0
 Identities = 440/552 (79%), Positives = 483/552 (87%), Gaps = 3/552 (0%)

Query: 1   MIRRLMALLSIAAFAPGVWAAEALTGAVQKQPLNVSAILMFVAFVGATLCITYWASKRNN 60
           M R L AL +   FA    AA+A++GAV++QP N  AI+MF+ FV  TL ITYWASKR  
Sbjct: 1   MKRVLTALAATLPFAAN--AADAISGAVERQPTNWQAIIMFLIFVVFTLGITYWASKRVR 58

Query: 61  SAADYYAAGGKITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSIGFLVGWPIIL 120
           S +DYY AGG ITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYS+GFLVGWPIIL
Sbjct: 59  SRSDYYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIIL 118

Query: 121 FLIAERLRNLGKYTFADVASYRLGQTQIRSLSACGSLVVVAFYLIAQMVGAGKLIQLLFG 180
           FLIAERLRNLG+YTFADVASYRL Q  IR LSACGSLVVVA YLIAQMVGAGKLI+LLFG
Sbjct: 119 FLIAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALYLIAQMVGAGKLIELLFG 178

Query: 181 LDYHVAVILVGILMCMYVLFGGMLATTWVQIIKAVLLLSGASFMALMVMKHVNFDFNALF 240
           L+YH+AV+LVG+LM MYVLFGGMLATTWVQIIKAVLLL GASFMA MVMKHV F FN LF
Sbjct: 179 LNYHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLF 238

Query: 241 SEAIKVHPKGEAIMSPGGLVKDPISAFSLGLALMFGTAGLPHILMRFFTVSDAKEARKSV 300
           SEA+ VHPKG  IM PGGLVKDPISA SLGL LMFGTAGLPHILMRFFTVSDA+EARKSV
Sbjct: 239 SEAMAVHPKGVDIMKPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSV 298

Query: 301 LYATGFIGYFYILTFIIGFGAILLVSTNPAFKDAAGALMGGNNMAAVHLANAVGGSVFLG 360
            YATGF+GYFYILTFIIGFGAI+LV  NP +KDAAG L+GGNNMAAVHLANAVGG++FLG
Sbjct: 299 FYATGFMGYFYILTFIIGFGAIMLVGANPEYKDAAGHLIGGNNMAAVHLANAVGGNLFLG 358

Query: 361 FISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKANEKDEIRVSKITTIALAVLAI 420
           FISAVAFATILAVVAGLTLAGASAVSHDLYA+V KKG A E++E+RVSKIT + L V+AI
Sbjct: 359 FISAVAFATILAVVAGLTLAGASAVSHDLYANVFKKG-ATEREELRVSKITVLILGVIAI 417

Query: 421 GLGILFEKQNIAFMVGLAFSIAASCNFPVLLLSMYWKKLTTRGAMVGGWLGLVSAVGLMV 480
            LG+LFE QNIAFMVGLAF+IAASCNFP++LLSMYW KLTTRGAM+GGWLGL++AV LM+
Sbjct: 418 ILGVLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLGLITAVVLMI 477

Query: 481 LGPTIWVQILGHEKAIFPYEYPALFSMAIAFVGIWFFSVTDKSAEGVNERALFFPQFVRS 540
           LGPTIWVQILGHEKAIFPYEYPALFS+ +AF+GIWFFS TD SAEG  ER LF  QF+RS
Sbjct: 478 LGPTIWVQILGHEKAIFPYEYPALFSITVAFLGIWFFSATDNSAEGARERELFRAQFIRS 537

Query: 541 QTGLGASGAVSH 552
           QTG G     +H
Sbjct: 538 QTGFGVEQGRAH 549


Lambda     K      H
   0.327    0.140    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1053
Number of extensions: 47
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 552
Length of database: 549
Length adjustment: 36
Effective length of query: 516
Effective length of database: 513
Effective search space:   264708
Effective search space used:   264708
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory