Align RhaQ (characterized, see rationale)
to candidate 15636 b1515 AI2 transporter (NCBI)
Query= uniprot:Q7BSH2 (337 letters) >FitnessBrowser__Keio:15636 Length = 330 Score = 156 bits (395), Expect = 6e-43 Identities = 97/306 (31%), Positives = 159/306 (51%), Gaps = 8/306 (2%) Query: 23 RIAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLVISGEI 82 RI WE+ L A+ V+ V +P LD L +T +F ++A + ++++SG I Sbjct: 2 RIRYGWELALAALLVIEIVAFGAINPRMLDLNMLLFSTSDFICIGIVALPLTMVIVSGGI 61 Query: 83 DLSVAAIIALASTAMGAAVQIGIGTPGLVLIGIGTGLACGVFNGVLVSVLKLPSIVVTIG 142 D+S + I L + A+G Q G+ P +L+ + G CG+ N L+ K+ +V+T+G Sbjct: 62 DISFGSTIGLCAIALGVLFQSGVPMPLAILLTLLLGALCGLINAGLIIYTKVNPLVITLG 121 Query: 143 TMSLFRGISYIV------LGDQAYGKYPADFAYFGQGYVVWVFSFEFVLFIVLAVLFAIL 196 T+ LF G + ++ G + G +P F F V+ + ++F++ ++F + Sbjct: 122 TLYLFAGSALLLSGMAGATGYEGIGGFPMAFTDFANLDVLGL-PVPLIIFLICLLVFWLW 180 Query: 197 LHATNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGSTRPSI 256 LH T+ GR V+ IG + A +S IPV R L+ +TG+ S +AAV L S GS R + Sbjct: 181 LHKTHAGRNVFLIGQSPRVALYSAIPVNRTLCALYAMTGLASAVAAVLLVSYFGSARSDL 240 Query: 257 AQGWELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVMSIFIGL 316 + + +T VVLGG +I GG G IA ++G + GL + +P V S G Sbjct: 241 GASFLMPAITAVVLGGANIYGGSGSIIGT-AIAVLLVGYLQQGLQMAGVPNQVSSALSGA 299 Query: 317 LIIVTI 322 L+IV + Sbjct: 300 LLIVVV 305 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 330 Length adjustment: 28 Effective length of query: 309 Effective length of database: 302 Effective search space: 93318 Effective search space used: 93318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory